CAZyme Information: RO3G_04703-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_04703-t26_1-p1
• CAZy Family: GH15
• CAZyme Description: chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
917		103778.37	8.3081

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476734:1326401-1329399(-)

Full Sequence      

MTDLQLPLGMKRSKSLSRPERQRRRTTMIQSQEIPHHLQCQLDEKRHQKEQEETEKTRMG
AWAWIAYLATCCIPSYFLRTCFGKSNKNMQQAWREKVTLCYLIALLCGLLAYIIYGLHLN
ICPEKAEGYPYSTLVNGTRQRVQRSEVSVFGKLYSFGTMQNFMQTQGMNLTTEFQGMELG
ALFDGDTHGACAPYRHGSADPTLSPCTVTGSQGQTLTSKNKTCIPLRKLQSYRPSTRYIS
FEWQDIHDHQLVLVGGSILNLTQYNNNFGPTVDQAIQSSKGNDMTYALLYTNQGKQARSC
LVARHSIGIATRELSGCIADKIIMNIMFAVVLAIIIIRYSMALLFQWVIARRLTKPGGRS
NWLAWRSVQGGNDDPANHATLLKSATSESSLESTERGRLNGTRSDIVNTELYTVMLVTCY
SEGEEGLRTTMDSLSNTTYSDQHKIFFVIADGLITGAGESRSTPDIVIDMMDLDPLMAHP
KACSYLAVANGEKQLNMAKVYAGHYNGTPCITIVKCGTEEEQRGPKAGNRGKRDSQVILM
TFFQRVLLNDRLTELDYDIFWKMTWLMKGVTPDRFETVLMVDADTEVLPDALTYMVAAMA
NDITIMGLCGETRIANKRASWVTAIQVFEYYISHHYAKAFESLFGMVTCLPGCFSMYRIK
APKCGAWVPILANPDIVLEYNQNTVTTLHEKNLLLLGEDRFLSTLMLRTFPKRQMMFVPQ
ARCRTVVPDTLSVLLSQRRRWINSTIHNLMELVLVSDLCGIACLSMQFSVFVDLIGTLVL
PAAIVMSIYLIVQTALSTDPQWQSLGLLVAILFLPAILISITTFKWIYICWLVIYICALP
VWNMLLPLYSFWHFDDFSWGATRVVVGEKKQEGHGDGEGIFDSKRLIMKTWRDWENERRG
LKPEPVKIRLKTPKDIF

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	404	897	2.4e-234	0.9658444022770398

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	0.0	401	897	15	527	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	1.43e-89	416	748	2	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	1.38e-22	565	859	128	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.25e-21	416	661	2	165	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404520	Glyco_tranf_2_3	3.80e-08	574	744	87	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS10376.1|GT2	0.0	62	915	188	1071
CDS03254.1|GT2	0.0	58	915	247	1140
CDS10247.1|GT2	0.0	268	900	8	659
CDS07743.1|GT2	5.02e-231	86	898	120	944
AZQ26802.1|GT2	5.69e-224	59	898	67	944

PDB Hits     

RO3G_04703-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13356|CHS1_CRYNH	2.53e-214	62	898	75	957	Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS1 PE=2 SV=2
sp|Q4P333|CHS7_USTMA	2.95e-208	4	898	36	954	Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS7 PE=3 SV=1
sp|P78611|CHSD_EMENI	1.78e-198	44	899	171	1169	Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsD PE=1 SV=4
sp|Q01285|CHS4_NEUCR	3.09e-196	62	899	211	1191	Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-4 PE=3 SV=3
sp|O13353|CHS4_MAGO7	5.18e-192	63	900	206	1187	Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CHS4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998571	0.001454

TMHMM  Annotations     

Start	End
60	82
97	119
328	350
770	792
805	827
831	853