CAZyme Information: RO3G_04525-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_04525-t26_1-p1
• CAZy Family: GH134
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529		58932.08	7.0350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476734:808613-810307(+)

Full Sequence      

MGGSSHIVWVLSILEELAARGHHVKFFTRDDHIRFAKKFPSIEPISSGPGIFTKEDYNRI
LPEMISMDSVTRAIFFADTFGNNYTEEYYKHRDIFNTEKVDLAVCDHFTMACSDAAEAAG
LPFVVTSSLAYSSGKAHTNLQDDYNDLFLISSDATAPYVNVDLINMHHPTSRGVSFFTRF
NDKVISPLRLVYGMRHVIKKSNQDRKSIGLKATMDPMDSWKDSIKIVNGAFGFEAPRPVG
PLVELVGPIVPLNHAGLNSELQTFLDHRRKVVYVAFGQMAIPTRNDVKMILTAMLENMET
GTIDGIIWSTRGIEELFPEYITTRSNTTYDIRSLFKSSSAPNETNIAFVNWAPQVAILHH
PSTTLFLTHGGAGSLHESLYNGVPVVVFPFFGDQPSAAILTEENGYGRYLKSSSSQEQAT
ALIADVALDQDGSYRQTVRRFQSLVQIRAHRGVQRGADLMEEALFANKDGKMVHRRDVKR
DLSTIVAYNLDIYAFIAVLILGSVSGLYRGAVYITQHLQTLPSTKLKSA

Enzyme Prediction     

No EC number prediction in RO3G_04525-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	239	445	3.8e-27	0.4083769633507853

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.95e-46	1	462	8	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	2.17e-25	5	495	11	469	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	3.66e-22	2	471	10	405	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	6.41e-17	2	461	4	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
223071	egt	1.72e-15	227	440	251	441	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	3.13e-189	2	529	47	548
AOC55049.1|GT1	2.23e-92	3	510	44	528
CDS06891.1|GT1	8.26e-84	1	504	54	531
CDS11218.1|GT1	2.56e-80	2	502	51	526
CDS06902.1|GT1	1.28e-75	1	493	48	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HBF_A	5.67e-14	232	402	210	385	Structure of UGT78G1 complexed with myricetin and UDP [Medicago truncatula],3HBJ_A Structure of UGT78G1 complexed with UDP [Medicago truncatula]
6J31_A	1.77e-11	345	464	280	394	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	1.80e-11	345	464	283	397	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
3WC4_A	3.76e-11	269	447	264	442	Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase from Clitoria ternatea [Clitoria ternatea],4REL_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with kaempferol [Clitoria ternatea],4REM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with delphinidin [Clitoria ternatea],4REN_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with petunidin [Clitoria ternatea],4WHM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with UDP [Clitoria ternatea]
2O6L_A	1.29e-10	345	395	69	119	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3UP75|UD3A1_MOUSE	1.25e-15	221	529	243	523	UDP-glucuronosyltransferase 3A1 OS=Mus musculus OX=10090 GN=Ugt3a1 PE=1 SV=1
sp|P35503|UD13_HUMAN	3.02e-15	223	501	253	501	UDP-glucuronosyltransferase 1A3 OS=Homo sapiens OX=9606 GN=UGT1A3 PE=1 SV=1
sp|O02663|UD2B9_MACFA	3.95e-15	5	496	34	497	UDP-glucuronosyltransferase 2B9 OS=Macaca fascicularis OX=9541 GN=UGT2B9 PE=2 SV=1
sp|P35504|UD15_HUMAN	5.32e-15	223	501	253	501	UDP-glucuronosyltransferase 1A5 OS=Homo sapiens OX=9606 GN=UGT1A5 PE=1 SV=1
sp|P22310|UD14_HUMAN	5.32e-15	223	501	253	501	UDP-glucuronosyltransferase 1A4 OS=Homo sapiens OX=9606 GN=UGT1A4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

Start	End
485	507