CAZyme Information: RO3G_04523-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_04523-t26_1-p1
• CAZy Family: GH134
• CAZyme Description: chitinase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		51917.29	6.4679

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476734:800858-802470(-)

Full Sequence      

MISCNILGITIAAFITSTLAAYSSNGVNVMYYWGQNSAGGSNTQGSLVSYCQSGQVDVII
LSFLNKFNMGGLPEINLASACEQTFFPNTNLLHCPTVGSDIKTCQSNGVKVLLSLGGAAG
SYGFSSDSEGQTFAETIWNLFGGGTSDTRPFDDAVIDGIDLDIEGGSSTGYAAFVTALRS
KGHFLIGAAPQCPFPDAILGSVIDAVGLDFVNVQFYNNVCSVASGSSFNFDVWNDWAKNK
SPNKNIKVMLTVPGSSTAAGSGYASIAELGPIVSSVISQYSSFGGVSVWDASQAWNNNGF
HSELYSIVHGSSAALGQAARKTPFPNTSSITTTSLATASSALFPLLYAGRSCSSQSKVSC
TSTGSYTICNYGKWVTAPCPPGVICLSSAQSNNTDLTVSAQFFITSFAGGSFKAIINARR
TTLTPFEKMKTIEFTVPDHVRLSQCNLGKIEQVGRSVRIRLKDHPNMAFVLNLSGNVSSD
AFVAPDPSSWRFS

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	28	260	8.5e-26	0.6722972972972973
CBM19	344	386	1.1e-21	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	3.81e-120	28	306	2	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
112252	CBM_19	8.15e-31	330	390	1	61	Carbohydrate binding domain (family 19).
395573	Glyco_hydro_18	6.74e-28	28	302	1	277	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	5.04e-19	29	241	2	198	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119363	GH18_CTS3_chitinase	2.67e-15	100	290	64	252	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAA01018.1|CBM19|GH18	0.0	1	493	1	493
BAA01021.1|CBM19|GH18|3.2.1.14	1.79e-199	1	492	1	539
BAA01022.1|CBM19|GH18|3.2.1.14	3.38e-195	1	492	1	541
CDS10560.1|CBM19|GH18	4.81e-128	8	492	11	568
ANB12166.1|GH18	5.49e-96	1	315	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	2.50e-87	24	297	3	272	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	2.39e-53	29	290	3	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]
1HVQ_A	2.97e-50	29	308	3	273	CRYSTAL STRUCTURES OF HEVAMINE, A PLANT DEFENCE PROTEIN WITH CHITINASE AND LYSOZYME ACTIVITY, AND ITS COMPLEX WITH AN INHIBITOR [Hevea brasiliensis],1LLO_A Chain A, HEVAMINE [Hevea brasiliensis],2HVM_A Hevamine A At 1.8 Angstrom Resolution [Hevea brasiliensis]
1KR0_A	1.66e-48	29	308	3	273	Chain A, Hevamine A [Hevea brasiliensis]
1KR1_A	3.24e-48	29	308	3	273	Chain A, Hevamine A [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29025|CHI1_RHINI	0.0	1	493	1	493	Chitinase 1 OS=Rhizopus niveus OX=4844 GN=CHI1 PE=3 SV=1
sp|P29026|CHI1_RHIOL	3.18e-200	1	492	1	539	Chitinase 1 OS=Rhizopus oligosporus OX=4847 GN=CHI1 PE=1 SV=1
sp|P29027|CHI2_RHIOL	6.00e-196	1	492	1	541	Chitinase 2 OS=Rhizopus oligosporus OX=4847 GN=CHI2 PE=1 SV=1
sp|P29029|CHIT_YEAST	2.91e-83	24	297	24	293	Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS1 PE=1 SV=2
sp|P40954|CHI3_CANAL	3.34e-78	9	297	5	295	Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000212	0.999770	CS pos: 20-21. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in RO3G_04523-t26_1-p1.