CAZyme Information: RO3G_04245-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_04245-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		31684.08	5.6209

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476734:81052-82077(+)

Full Sequence      

MKGLYPHLINVNTGLPVGDHFTWGGMADSFYEYLIKQLVTSEGKDQVKFKMVKEIISSLE
NQLLVTSSMDPKTSFLVEINGNRSTNRMDELACFAPASLILAARSFPKEFKHVEAIAERL
LYGCYSAWDSTATGLAPEVFTWDVQSRFYEQIPSVAPVIKSYILRPETLESLYYFYAYTH
NPVYQDMAWDIFNSLYTYCKTNSGYSGLYDVQDTEYPWDDREESFFFAETLKYLYLIFDD
HKQLRFPFDQWVFNTEAHPLKIHKKKPTLLKK

Enzyme Prediction     

EC	3.2.1.113:73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	3	262	2.9e-70	0.57847533632287

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.27e-97	3	262	189	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.65e-79	2	265	262	521	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFO96093.1|GH47	1.44e-50	2	262	367	620
CDS03956.1|GH47	1.60e-50	3	265	221	486
AHH39789.1|GH47	1.68e-48	2	266	352	609
AEP99235.1|GH47	2.19e-47	2	262	89	342
AWP20361.1|GH47	4.65e-47	2	268	356	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KKB_A	8.03e-49	2	262	214	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	9.50e-49	2	262	212	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KIJ_A	2.08e-42	3	262	193	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	2.30e-42	3	262	198	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	2.38e-42	3	262	198	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45701|MA1A1_RABIT	2.22e-47	2	262	203	456	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=MAN1A1 PE=1 SV=1
sp|P45700|MA1A1_MOUSE	6.10e-47	2	262	389	642	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
sp|O02773|MA1A1_PIG	1.22e-46	2	262	393	646	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Sus scrofa OX=9823 GN=MAN1A1 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	2.25e-46	3	262	287	537	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|O60476|MA1A2_HUMAN	3.71e-46	2	262	373	626	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000001

TMHMM  Annotations     

There is no transmembrane helices in RO3G_04245-t26_1-p1.