CAZyme Information: RO3G_04103-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_04103-t26_1-p1
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271		31433.33	4.7480

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476733:4813086-4814200(+)

Full Sequence      

MHHCNLDIEVWHLSDEKPSALMINELTALGATARDLSYSNLPRPIEHRRDADKQFQIKAA
AIINSAFKEVLYLDSDNIPARDPTFLFDTPEYKKTGALFWPDFWKTHGENKIFEILQISC
NDEWEQESGQMVINKEKSWLPLQLAWYMQDQYEIYFQFLNGDKDTFKYAWQALSAPYHMV
ETFLGMAGTMPSPGMPNNIEHPWDLVKRSTFSHSNTWIKPEFYVSGNGQACMDFTHREGE
PDAITESFDRILPELQNNYFKFGGIGGETRQ

Enzyme Prediction     

No EC number prediction in RO3G_04103-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	3	190	2.6e-44	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	7.57e-29	4	190	28	253	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13715.1|GT71	1.23e-115	4	270	179	482
UPK71667.1|GT71	7.16e-47	4	194	73	256
QDW24358.1|GT71	3.82e-43	4	188	73	248
AYD49054.1|GT71	1.52e-42	4	181	83	252
CDS91369.1|GT71	2.69e-40	4	215	72	274

PDB Hits     

RO3G_04103-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	8.50e-15	53	194	327	514	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q5AD72|MNN24_CANAL	4.90e-11	55	183	367	535	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|P46982|MNN5_YEAST	6.14e-11	55	182	226	410	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|A6ZQE9|MNN5_YEAS7	2.00e-10	55	182	226	410	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|Q5AP90|MNN23_CANAL	2.03e-10	55	271	252	481	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_04103-t26_1-p1.