CAZyme Information: RO3G_04015-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_04015-t26_1-p1
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708	CH476733|CGC13	82296.33	5.8135

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476733:4579354-4581531(+)

Full Sequence      

MFIDFFIFADDKNKARRFLIDVEETQRKILEQEDTDGDFQITINDLGPKTMSLGTADSGG
YRKIDIRGTYMLSNLLQELALANDYGRKHIVLDEARLNENPVDRLSRMIRFNFWDGLTRR
IDADSLEVICPDPKNRSSNKNPRIYVPHEDHEAYGFYKQVAEIRKHLNLEVEYLPKEITA
DYVKNINDRPGLLTLAMRKVKDENGNNTFVGEPFVVPGGRFNEMYGWDSYFSALGLLEDG
RLELVRSMVENFAYQIKHYGKILNANRSYYLARSQPPFLTDMALKVYERLSPEKENKDWL
RRILKSAMKEYWEVWMGEPRLDKKTMLSRYRPDGTGIPPETEASHFVHILEPFAKKHNIS
LDEFIEKYNDKIIKEPELDEYFLHDRAVRESGHDTTYRFDKVCANLATIDLNALLYKYEM
DIADAIRDYLDDDLEDFDGIKQNATDWLERARLRRERIDKYLWNEKESLYFDYDTIKEEQ
TTYESVTTFWALWAGCASHEQAQSMVKHSLSKFEVMGGLVSGTESSRGAISLERPNRQWD
FPFGWAPHQMMAWVGLDKYGMIETARRLAYRWLFTITKGFVDFNGVVPEKFDVVSLSHKV
EVEYGNVGTDFKCVPREGFGWMNASYQVGLSYLTTHMRRALGTCTLPDLLFEKAMIREHR
MFGMTPEEEEAVALRRRTSTIAARAITRNGSINAAVTRISLSDAPPKQ

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	85	631	2.3e-152	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	0.0	84	633	2	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	1.60e-180	15	639	7	558	Neutral trehalase [Carbohydrate transport and metabolism].
183934	treF	3.76e-53	212	623	160	536	alpha,alpha-trehalase TreF.
237326	treA	9.26e-53	212	623	148	526	alpha,alpha-trehalase TreA.
183936	treA	2.65e-51	213	623	150	526	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12450.1|GH37	0.0	10	699	60	749
CDS14080.1|GH37	0.0	10	699	61	746
CDS07923.1|GH37	0.0	9	700	64	739
AAX19735.1|GH37	0.0	10	654	55	700
AAX19736.1|GH37	0.0	10	657	58	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JTA_A	1.62e-272	8	664	88	751	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5N6N_C	2.73e-272	8	664	93	756	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5NIS_A	3.75e-272	21	664	6	656	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5M4A_A	1.03e-248	71	664	3	603	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	4.97e-43	212	623	114	492	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42893|TREA_SCHPO	4.06e-288	10	651	73	716	Cytosolic neutral trehalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ntp1 PE=1 SV=1
sp|O42783|TREB_NEUCR	6.06e-280	14	655	79	732	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|O42777|TREB_EMENI	1.02e-277	16	655	87	737	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2
sp|O42622|TREB_MAGO7	7.49e-274	10	655	68	724	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2
sp|A0A384JRP0|TREA_BOTFB	7.75e-274	10	655	69	725	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000001

TMHMM  Annotations     

There is no transmembrane helices in RO3G_04015-t26_1-p1.