CAZyme Information: RO3G_03504-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_03504-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		38829.14	6.2322

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476733:3225334-3226385(+)

Full Sequence      

MGPSKVIPYYFKATEALDSEDVTIATLVTHNRFPVLSRLATRYQGPISVAIHINDDATKQ
TILKDLHAMYETNPDMGRFVDIHLVVDKLDRQFNMWRNVAKFFARTEYIMMLDVDFHLCT
DFRQSLRKHTDLMDILRQGKGAVVVPAFEYLAEEDGEDWRTFPTTKEALIDIVQQEKIDM
FHITWTRGHGSTNYTKWYASNDPYKVEDYNYSYEPYVIYKKEGSPWCDERFVGYGANKAA
CLYEIYLAGIDYWVLPDDFLIHQTHHYPEDTRAKERKYNKRLYDYFREEVCLRYARLMIS
AGLWETSTADNLRSECTKIKGFKEMVAHVL

Enzyme Prediction     

No EC number prediction in RO3G_03504-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	14	294	1.7e-48	0.8338278931750742

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	1.20e-56	21	294	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS14203.1|GT49	2.68e-203	1	329	98	427
CDS06289.1|GT49	2.53e-198	1	329	96	424
CDS09884.1|GT49	3.44e-174	1	323	65	387
CDS06217.1|GT49	3.75e-167	1	324	106	429
CDS10115.1|GT49	1.39e-163	1	327	101	427

PDB Hits     

RO3G_03504-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O95461|LARG1_HUMAN	6.16e-30	10	265	462	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q66PG3|LARG1_CHICK	6.97e-29	10	265	462	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Gallus gallus OX=9031 GN=LARGE1 PE=2 SV=1
sp|Q9Z1M7|LARG1_MOUSE	9.44e-29	10	265	462	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|Q6P7A1|LARG2_RAT	2.16e-28	21	265	401	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1
sp|Q5XPT3|LARG2_MOUSE	2.93e-28	21	265	402	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_03504-t26_1-p1.