CAZyme Information: RO3G_03324-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_03324-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		33066.73	8.1406

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476733:2791497-2792456(+)

Full Sequence      

MKFITITSSALLALALGTEMASAAKCSKLYGQCGGKDWNGPTCCESGSTCKVSNDYYSQC
LAPESNGNKTSESAHKTTTTTAPAKEITTTAKASNSSNSSGKYSIVSGGASGNGVTTRYW
DCCKASCSWPGKANVSSPVKSCNKDGVTALSDSNVQSGCNGGNSYMCNDNQPWAVNDNLA
YGFAAAAISGGGESRWCCSCFELTFTSTSVAGKKMVIQVTNTGGDLGSSTGAHFDLQMPG
GGVGIFNGCSKQWGAPNDGWGSRYGGISSASDCSSLPSALQAGCKWRFNWFKNADNPSMT
YKEVTCPKEITAKTGCSRK

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	114	316	9.1e-92	0.98989898989899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	4.52e-77	114	316	2	213	Glycosyl hydrolase family 45.
395595	CBM_1	1.93e-11	29	57	1	29	Fungal cellulose binding domain.
197593	fCBD	2.09e-10	28	61	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACK18399.1|CBM1|GH45|3.2.1.4	3.66e-213	1	319	1	366
ABA29989.1|CBM1|GH45|3.2.1.4	3.66e-213	1	319	1	366
BAC53988.1|CBM1|GH45|3.2.1.4	3.66e-213	1	319	1	366
BAC53956.1|CBM1|GH45|3.2.1.4	3.13e-205	1	319	1	338
ABA29988.1|CBM1|GH45|3.2.1.4	3.13e-205	1	319	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H4U_A	1.69e-100	104	318	12	221	Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_B Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_C Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus]
5GLY_A	5.29e-95	110	318	1	202	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	6.06e-95	110	318	4	205	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
6MVI_A	1.43e-91	110	318	22	223	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
1L8F_A	3.06e-85	113	318	2	200	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D3GDK4|GUN_CRYAT	7.07e-100	104	318	12	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|P43316|GUN5_HUMIN	1.26e-82	113	318	2	201	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|P45699|GUNK_FUSOX	1.36e-81	110	318	18	221	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|O97401|GUN_PHACE	1.48e-64	106	317	32	241	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P54424|GUN1_USTMA	8.97e-54	114	319	27	237	Endoglucanase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EGL1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999740	CS pos: 23-24. Pr: 0.9698

TMHMM  Annotations     

There is no transmembrane helices in RO3G_03324-t26_1-p1.