CAZyme Information: RO3G_03240-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_03240-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789		90090.77	7.2259

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476733:2591642-2594553(-)

Full Sequence      

MARITEKRVVIATLFLPWTVDFELLERKEKNRLIAKTEEKNNIKPNLIQSLAQRNQQSKE
EQEELFDFKEPEKLVQPRSKQQREEEIKKIPHLFISNRKFSPVDSAQAFADAPWSAKPSS
VGNIGLNNALFSIQDRLENLAWVGTLGMSTDTLSEKTKQEISTRFEERYNAYPVMPSDTV
FEGHYNRYCKQDFADMIVNNYKEGDIIWINDYHLMLVPGMIRQKLPNAIIGFFLHIPFPS
SELFRCLPPRKELLEAMLQSDVIGFQTYSFARHFLQTCSRILSVDVTPTGIQLDTHYCSV
GIYPIGIDIDALSKKILDPEVNHWISKLKEKYAGKKLIVARDKLDYIKGVRQKLLSFEQF
LIRHPEWRGEVVLIQIALSTSEQNELRAHISDVVSRVNFKFSTISYQPIVFLHQDISFSQ
YLALLTCADTCLLTPLRDGMNLTSHEYIVCQKDTFNPLILSEFTGTYGSFGASLRVNPWD
YRQIGEAIHDALSMSIDEKAARWKELYKSIEANSAQQFASNVISSLSKVQSHPTRRFSTK
IPKLSATILNEACKNYKKRLFLFDYGGTLIPHGKPPSSKYIARVLDLLTKLTSDPNNTIY
VISGRTKINVDTDLGSVPNLGLSGGDWQQIYDNIDFSWKPTVKDIFQYYTERTPGAYVES
KDTSIVWHYRTTEGADSQYISWQAAECQNHIADSVNKNFAVHAVIGNTSIEVIPHDVNKS
SIANRILQDINPDFVLSIGDDRSDEDMFTFLNKQKNLKVITCKVGARGTEARYYIPNVDA
VLSTLEQLF

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	191	527	1.3e-137	0.7178947368421053

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	93	526	3	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	93	788	4	723	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	9.04e-178	95	526	6	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	3.69e-155	95	532	20	483	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	1.30e-146	93	788	14	783	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09009.1|GT20	0.0	8	788	5	886
AMJ52388.1|GT20	1.06e-238	8	778	9	828
EGX50369.1|GT20	4.63e-196	95	788	155	910
CCD42256.1|GT20	1.25e-188	107	788	156	906
ATZ46284.1|GT20	1.83e-188	107	788	169	919

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	1.09e-105	93	529	3	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	1.29e-99	142	526	56	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVM_A	2.11e-97	142	544	57	492	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	8.63e-95	120	528	28	469	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	8.63e-95	120	528	28	469	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54NU9|TPSB_DICDI	2.38e-147	134	788	90	787	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|O14081|TPSX_SCHPO	3.15e-139	106	758	192	903	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	1.35e-137	98	788	147	889	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	1.63e-137	93	777	19	723	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|P78875|TPP1_SCHPO	6.72e-126	169	777	174	796	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000002

TMHMM  Annotations     

There is no transmembrane helices in RO3G_03240-t26_1-p1.