CAZyme Information: RO3G_02664-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_02664-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		40723.33	6.3704

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476733:1133921-1135257(-)

Full Sequence      

MTHGLKMHKLFSKSYYDAAKNIQPFWLKASNTPSNDQVSIITAVTAKTWPNLLRLTVYWD
GAQDELSMERLEQEYREIPELYNNVDLHLVRVPGEKPSVLFPRNAERNLARLLSRTEYIM
DVPSDMIPASDLRRTLEANKKKIKELLEAGDLLALPTFTFREKDVQKEDIPVDKGHLINN
LHEGKMVLNDKHWKENEGPTDLDKWIDANTLYSIEKYEFHYEPVVIESKTVQPWCSERFL
DSRAACIFSSYLQGNEIYVMPDDYVVQMPDNHAPEVSDFDHVVENRIYAKFYWEQCVHHA
RQLDALGLWNNPRSRHIRSQCSRVIQNWGKGLIGKPDCTFFIMFYRVN

Enzyme Prediction     

No EC number prediction in RO3G_02664-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	43	296	3.5e-18	0.7418397626112759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	3.13e-15	99	266	113	289	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07474.1|GT49	6.52e-142	1	337	178	525
CDS11928.1|GT49	2.62e-127	1	337	162	510
CDS14416.1|GT49	8.51e-58	1	321	133	478
CDS06192.1|GT49	2.65e-57	1	330	134	480
CDS10115.1|GT49	4.11e-45	1	324	87	419

PDB Hits     

RO3G_02664-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

RO3G_02664-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_02664-t26_1-p1.