CAZyme Information: RO3G_01857-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_01857-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		66972.75	5.9566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476732:4802274-4804311(+)

Full Sequence      

MVFYSLRILYGLLITQLALSVVAIQPQTSHSCDSPIYCEGPILKTVQLAELYSDSKTFVD
MPTSKSEAEVVKAFNAMGGVNATKDQVKQFVKENFLEAGAEVKMLTNVTIQEELSWIQDI
SNVDYQGWINHLNHAWENLTFGFDYSALCKDCVSSTLPVEHPFVVPGGRFREFYYWDSFF
VIKGLLLSEQPPFLSLMVDIYYEKTKDKEFMEYALPYLDKEYDFWMKNTSVHIKDPRNQK
KTHVLNRYITQHKSPRPESYVEDYNTVNVNVSFSDSVKDQMFADIAAGAETGWDYSSRWT
KNKVPSPQQVESYEMLRTINTHNIIPIDLNSLLWNMETSLSKWHKQFGSQNKASKKKSRY
YAQQAKKRLEAIDKLMWNDETTSFYDFNLTSNAQNIEYTPANLYPLWLNVIPDHLLKNKT
KLASTMDETERTLRKYPGILTTSYHNTTMQWDLPNGWPPLTFIAIQSFLNIDSILNTQSK
SYTTSFGTTFNRLAEVLAERYAASAYCGWYKTGGSIPGVLPKLSSVSDDGHMFEKFDVTT
IGAAGGQGEYTSQVGFGWTNGVAMWIFSSFNNLTAPSNCSETITISL

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	190	567	4e-96	0.6435845213849287

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.11e-117	50	562	1	500	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	6.60e-103	37	564	13	538	alpha,alpha-trehalase
237326	treA	2.66e-78	8	564	19	530	alpha,alpha-trehalase TreA.
183936	treA	1.89e-73	42	564	52	530	alpha,alpha-trehalase TreA.
224541	TreA	8.83e-68	34	563	53	545	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03696.1|GH37	7.57e-199	15	584	18	599
CDS07813.1|GH37	7.17e-190	32	581	33	577
UJO12022.1|GH37	4.32e-119	32	576	27	631
SMY28604.1|GH37	1.13e-114	32	579	27	632
SMR59387.1|GH37	4.46e-114	32	580	27	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JG0_A	1.66e-61	27	564	2	496	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	7.96e-61	34	564	46	533	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	4.47e-58	27	564	2	496	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	1.77e-57	54	564	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	2.40e-56	54	564	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	6.10e-101	32	579	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	3.01e-91	32	572	25	549	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	4.15e-89	32	572	28	552	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|P19813|TREA_RABIT	4.19e-87	32	572	28	551	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|A8J4S9|TREA_APIME	7.37e-86	5	582	11	581	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000261	0.999705	CS pos: 23-24. Pr: 0.9486

TMHMM  Annotations     

There is no transmembrane helices in RO3G_01857-t26_1-p1.