CAZyme Information: RO3G_01554-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_01554-t26_1-p1
• CAZy Family: CE20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		34384.94	9.9042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476732:4033004-4034077(-)

Full Sequence      

MAYNRLLLFVCIALLSILYTEASEATELEKRGSNSWYFSNWNKYKSDTIVGLTSQWNEKW
KIPKHRGWLWAWSGYEDSNAAVKDPAKKNSNDYVLRVKYNAHSRNPEGSLTGGLGFLAEP
ITVSKRAKTVSLQYSVYFPKNFDFVKGGKLPGVFGGNGECTGGDESGSCFTSRLMWRDDG
LGEIYAYLPHNKQRSDICDNKVNICNSDYGYSLGRGQFEFKKGAWTTVRQVLTLNQVNKR
NGRMILYVNGVKKVDIKNVVIRTSTTPNTVGIMFHTFFGGSDNTWATPKTQYSYFKNFKF
QVN

Enzyme Prediction     

EC	4.2.2.26:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL14	92	301	1.2e-58	0.97

CDD Domains     

RO3G_01554-t26_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05384.1|PL14_3	3.46e-89	33	303	27	289
CDS02791.1|PL14_3	2.87e-85	32	298	24	283
BAL22352.1|PL14|4.2.2.3	6.18e-57	76	303	60	283
ABO26618.1|CBM2|PL14	1.21e-54	76	303	174	392
AFQ98374.1|PL14	1.23e-51	78	298	46	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GMT_A	1.22e-43	75	299	39	269	Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai],5GMT_B Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai]
3A0N_A	9.94e-17	94	301	39	241	Crystal structure of D-glucuronic acid-bound alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_A Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_B Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3IM0_A Crystal structure of Chlorella virus vAL-1 soaked in 200mM D-glucuronic acid, 10% PEG-3350, and 200mM glycine-NaOH (pH 10.0) [Paramecium bursaria Chlorella virus CVK2]
6KCW_A	1.12e-10	113	297	56	234	Structure of alginate lyase Aly36B [Chitinophaga sp. MD30]
6KZK_A	4.14e-09	113	297	56	234	Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30],6KZK_B Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30],6KZK_C Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30]
6KCV_A	1.05e-08	113	297	56	234	Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_B Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_C Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30]

Swiss-Prot Hits     

RO3G_01554-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999772	CS pos: 22-23. Pr: 0.9830

TMHMM  Annotations     

There is no transmembrane helices in RO3G_01554-t26_1-p1.