CAZyme Information: RO3G_01340-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_01340-t26_1-p1
• CAZy Family: CBM21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		88002.97	6.9149

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476732:3500521-3503280(-)

Full Sequence      

MWNSVIKNLGLSSTEEYVKPRLSIGKAVAHQEFSTGHFKIQVDPEALALIVKNGNDRIIW
KSIQNQPFLSSTLGIDEIICENNGVFKVTEQNERPTRIQTITKIEKADKDTIKIYGGLGL
KLVLPTHMDYVFTFKELTHRQLQFSVEVTHRDNSMKDYSRLILTYESRPEEHFYGFGEQF
SYASLKGQKVPILIREQGDGSGAQPATSLKDSALSILGSSSVDNFATYASIPQYISSDIR
CLFMENSEYMSFDLTELDRVSIRVDSDHLKGRILDGKTMLDLLTEYTSFAGRMIPLPDWT
SEGIIAGIQGGKDKVNDIVKRLKEKNIPLAAVCIEDWTGLRTQSMGRGVQFNRQWWNWES
ADEQYPDWDKFIQDLSSMDEKVRVLSYVNPCLSNPSGKGRFKKNLFAEAQDKGYLVKGTQ
SSSSDATALSLKFGMGLEAGLLDLTNPEARNWFKEVLKEQVWGAGVSGMMIDFGEHLPYN
PKTVLLHSNENASVYHNHYSEEWALLHYELIKELGNEDEALCFFRSGYLHSPKYMNLFWA
GRQNVTWDQNHGIKSAIIGMLSSGFSGFSVTHCDVGGYNTVVSNIPGFKMFRSKELLLRW
MELGAFTAVFRTSEGIIPSLNSQFYDNDDTFAHLSHTTKLFLSIAAYRKQVLKEAYVKGW
PLMRHPVLYYPNDKIARVLTYQQYMLGSSLMIAPVLSPSASYVKVYFPKDAQNISWRHIW
TGKYYPGDGTYKAVDAPLGQPAVFVKEPRDDDGLLNDLLNYATTYYQQKARPPSGNK

Enzyme Prediction     

No EC number prediction in RO3G_01340-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	274	747	1.5e-81	0.9812646370023419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	0.0	157	747	68	619	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	1.86e-163	291	638	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	1.45e-88	67	747	44	666	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	5.98e-61	273	747	2	438	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	1.19e-38	363	709	55	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13477.1|GH31	3.75e-310	1	765	1	761
QIN82013.1|GH31	5.26e-178	99	747	108	722
CAP79722.1|GH31	3.98e-170	30	761	20	747
CAK39259.1|GH31	4.26e-169	55	745	47	742
QQK47473.1|GH31	1.25e-168	38	761	29	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AEE_A	8.77e-107	153	746	109	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5AED_A	1.72e-106	153	746	109	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
6PNR_A	2.30e-102	170	747	111	650	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5OHS_A	3.66e-85	159	758	98	660	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHY_A	7.09e-85	159	758	98	660	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	7.20e-106	153	746	109	663	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|P31434|XYLS_ECOLI	9.46e-35	171	747	160	665	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|Q9F234|AGL2_BACTQ	1.29e-27	171	747	147	670	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q9BE70|GANC_MACFA	1.73e-17	349	732	245	616	Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis OX=9541 GN=GANC PE=2 SV=2
sp|Q8TET4|GANC_HUMAN	1.99e-17	349	732	390	761	Neutral alpha-glucosidase C OS=Homo sapiens OX=9606 GN=GANC PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_01340-t26_1-p1.