CAZyme Information: RO3G_00916-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_00916-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	CH476732|CGC8	54043.66	4.5317

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476732:2329720-2331832(-)

Full Sequence      

MQFDFDGEHDVDLGWMKEVRKAKIVPRFQFRGWTGEDLRAFIASAEESNLLAKEINDQAN
KYGFDGVVIECGYPAFFQKLLMTLSSLLHQNDKELIVVLPSLLSEQYRQIMTAEVFSTLA
QYVDRFSLMTYDYSSHDPNGGPNAPIEWIMENIEYMTNEANRHKLMIGLNMYAMSYLPTR
VPEPLVMKTVVEKLSMPRGDELLMTGDEVDENEELNWDKENQEAWFVDYDEDGVRQGVIW
LPTLRSIRNRLRLAEDYGVGVALWEVGQGLDYFNIDVYFWKFFLFFFFLLLKHRMELDDY
YNIDDILAEHTKVPCTVLYDFEKEANLSGDEVAVPRNTRVELPYWVAKPLAQYTNLIAIE
IPRTYGTKVRNMLVASPESVDFRSLGAYFYEFGVKLVDFVVDEKLPGILEKAFKQRIKGI
MNYSQSSGSTVGQDFIQKLDETEKDCKLKWDRLHKVVLNSFYTSV

Enzyme Prediction     

No EC number prediction in RO3G_00916-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	31	269	9e-31	0.7263513513513513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119355	GH18_SI-CLP	9.81e-69	2	273	43	314	Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome. SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2. Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.
212551	GINS_A_psf3	2.64e-29	356	445	1	91	Alpha-helical domain of GINS complex protein Psf3 (partner of Sld5 3). Psf3 is a component of GINS, a tetrameric protein complex. Psf3 expression is up regulated in malignant colon cancer and it might be involved in cancer cell proliferation. GINS is a complex of four subunits (Sld5, Psf1, Psf2 and Psf3) that is involved in both initiation and elongation stages of eukaryotic chromosome replication. Besides being essential for the maintenance of genomic integrity, GINS plays a central role in coordinating DNA replication with cell cycle checkpoints and is involved in cell growth. The eukaryotic GINS subunits are homologous and homologs are also found in the archaea; the complex is not found in bacteria. The four subunits of the complex consist of two domains each, termed the alpha-helical (A) and beta-strand (B) domains. The A and B domains of Sld5/Psf1 are permuted with respect to Psf1/Psf3.
227467	COG5138	3.00e-25	299	455	2	159	Uncharacterized conserved protein [Function unknown].
119353	GH18_CFLE_spore_hydrolase	2.41e-22	17	268	52	304	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
412029	GINS_B_Psf3	2.40e-18	300	362	1	64	beta-strand (B) domain of GINS complex protein Psf3. Psf3 (partner of Sld5 3) is one of the proteins known to comprise the GINS (named from the Japanese go-ichi-ni-san, meaning 5-1-2-3 for the Sld5, Psf1, Psf2, and Psf3 subunits) complex, which is a macromolecular protein complex associated with DNA replication. Psf3 is dysregulated in cancer cells, and its overexpression may be related to tumor progression in some cancers including colon, breast, and lung cancers; its expression can be used as a prognostic indicator in some cancers. GINS is a complex of four subunits (Sld5, Psf1, Psf2 and Psf3) that is involved in both the initiation and elongation stages of eukaryotic chromosome replication. Besides being essential for the maintenance of genomic integrity, GINS plays a central role in coordinating DNA replication with cell cycle checkpoints and is involved in cell growth. The eukaryotic GINS subunits Sld5, Psf1, Psf2, and Psf3 are homologous, and homologs are also found in archaea; the complex is not found in bacteria. The four subunits of the complex consist of two domains each, called the alpha-helical (A) and beta-strand (B) domains. The A and B domains of Sld5/Psf1 are permuted with respect to Psf1/Psf3. This model represents the B-domain of GINS subunit Psf3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11651.1|GH0	1.11e-89	3	273	70	322
AAH13642.1|GH0	7.64e-43	3	273	47	315
BAH13441.1|GH0	2.09e-42	3	273	151	419
AFI38071.1|GH0	5.84e-42	3	273	121	389
CAF32458.1|GH0	5.84e-42	3	273	121	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BXW_A	2.02e-43	3	273	121	389	Crystal Structure of Stabilin-1 Interacting Chitinase-Like Protein, SI-CLP [Homo sapiens],3BXW_B Crystal Structure of Stabilin-1 Interacting Chitinase-Like Protein, SI-CLP [Homo sapiens]
6XTX_C	3.19e-15	298	444	17	173	CryoEM structure of human CMG bound to ATPgammaS and DNA [Homo sapiens],6XTY_C CryoEM structure of human CMG bound to AND-1 (CMGA) [Homo sapiens],7PFO_F Chain F, DNA replication complex GINS protein PSF3 [Homo sapiens],7PLO_F Chain F, DNA replication complex GINS protein PSF3 [Homo sapiens]
2E9X_C	3.37e-15	298	444	20	176	The crystal structure of human GINS core complex [Homo sapiens],2E9X_G The crystal structure of human GINS core complex [Homo sapiens]
2Q9Q_D	3.43e-15	298	444	21	177	The crystal structure of full length human GINS complex [Homo sapiens],2Q9Q_H The crystal structure of full length human GINS complex [Homo sapiens]
2EHO_D	4.97e-14	298	444	17	173	Crystal structure of human GINS complex [Homo sapiens],2EHO_H Crystal structure of human GINS complex [Homo sapiens],2EHO_L Crystal structure of human GINS complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0JPQ9|CHID1_RAT	7.47e-43	3	273	121	389	Chitinase domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Chid1 PE=2 SV=2
sp|Q9BWS9|CHID1_HUMAN	1.04e-42	3	273	121	389	Chitinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHID1 PE=1 SV=1
sp|Q5RFF6|CHID1_PONAB	1.04e-42	3	273	121	389	Chitinase domain-containing protein 1 OS=Pongo abelii OX=9601 GN=CHID1 PE=2 SV=1
sp|Q922Q9|CHID1_MOUSE	1.04e-42	3	273	121	389	Chitinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Chid1 PE=1 SV=1
sp|Q5EAB4|CHID1_BOVIN	7.43e-41	3	273	121	389	Chitinase domain-containing protein 1 OS=Bos taurus OX=9913 GN=CHID1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_00916-t26_1-p1.