CAZyme Information: RO3G_00874-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_00874-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		83319.45	4.7607

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476732:2211121-2213806(-)

Full Sequence      

MWFDANDLQGFQRIRHACDQGDGIEGYGYHKHDGREFASQVIHDTPSNIKLSTEFIKIPE
GKHGGDWGVRIRGVPINNEVPAVTSVMFYVGIEGEGGIDIMNKLSKKGLESPVRLEGDTP
ELGDFEIQIVDGPLNSYLGQGIDQDLSRTQWLDFVGEHIVTNARQRIEDGTLTTDQIYSE
PYKLLTLSNSLIEEEGQVANFYTFQKLFHGEFQFDILFRSSSFFKPLTSEKLSTALVSKE
QEFNARFESIFHLKEKGFSTGEVEFAQYLLSNLLGGVGYFHGSSVIDRSHPPMQDEEDFK
GEPIKPELSSPQTLFTATPSRPFFPRGFFWDEGFHQLVIGEWDNDLSVDIVQSWVSLIDE
NGWIAREQILGEEARSKVPSEFQTQFAHYANPPTLYLAIRKFIDRLEDHQQQRALGDITG
NPMRMGSLDDVEVLRNLHLDQPELADQWLKSVYPKLRQNWLWFRATQRGRGNEFGREAKN
NEAYRWRGRTPDHTLTSGLDDYPRGEPSVGELHLDLHSWMVFGTTLLKDIAHKLGVEDDV
REYDKVQEDLLINLDTLHWNEDQQMYCDQALEAEKFIHVCHKGYLSLFPMALGLLPPDSP
KLGAILDMLENEKELWSPYGLRSLSASDPFFGQGENYWRGPIWLNINYLTLQSLYRNYMV
PGPYQARAQTIYNQLRDNIIRNVYKDYQKTGYVWEQYSPETGEGMRSHPFTGWTSLVLLI
MAEKY

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	511	723	2.5e-30	0.43508771929824563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	227	723	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.71e-54	1	150	27	181	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	5.37e-10	529	719	432	600	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	2.63e-06	515	721	579	779	alpha-glucosidase; Provisional
283786	GDE_C	3.81e-05	531	677	183	334	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13455.1|GH63	0.0	1	725	68	804
VWO98679.1|GH63	2.62e-244	1	725	51	771
QRW00106.1|GH63	1.20e-243	1	725	1	744
QRW14633.1|GH63	4.83e-243	1	725	1	744
QRV86063.1|GH63	4.83e-243	1	725	1	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.60e-145	1	723	43	802	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.78e-139	14	725	77	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.09e-195	1	725	68	808	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	1.50e-144	1	723	73	832	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	7.89e-141	1	725	118	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	2.59e-139	1	725	120	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	6.08e-136	1	725	118	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000001

TMHMM  Annotations     

There is no transmembrane helices in RO3G_00874-t26_1-p1.