CAZyme Information: RO3G_00383-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_00383-t26_1-p1
• CAZy Family: AA12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240		25506.95	8.8291

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476732:942750-943529(+)

Full Sequence      

MKVSAIAASLFLVVMTNSDVVSAGYTGIKGGATGTSQATRYWDCCKPSCGWNGKAKVSAP
VRTCAKNGVTLVGTNVQSGCANGGAYTCNNNQPWVVNNNLSYGFAAARIPGGGEDRWCCS
CFELTFTSTPAKGKKMVVQVTNTGYDAGTEKGTHFDLLMPGGGVGLFNGCQSQWNTPTDG
WGARYGGVWNKQMCSKLPAQLRKGCEWRFGWFQGADNPTLTYREVTCPKEIVAVSGCARK

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	37	237	1.5e-85	0.9848484848484849

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	1.55e-72	38	237	4	213	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACK18399.1|CBM1|GH45|3.2.1.4	2.10e-111	17	240	142	366
ABA29989.1|CBM1|GH45|3.2.1.4	2.10e-111	17	240	142	366
BAC53988.1|CBM1|GH45|3.2.1.4	2.10e-111	17	240	142	366
BAC53956.1|CBM1|GH45|3.2.1.4	2.38e-111	25	240	122	338
ABA29988.1|CBM1|GH45|3.2.1.4	2.38e-111	25	240	122	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H4U_A	1.12e-90	20	239	5	221	Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_B Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_C Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus]
5GLY_A	2.72e-87	32	239	1	202	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	3.11e-87	32	239	4	205	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
6MVI_A	3.49e-84	32	239	22	223	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
1L8F_A	2.48e-79	37	239	4	200	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D3GDK4|GUN_CRYAT	4.73e-90	20	239	5	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|P45699|GUNK_FUSOX	3.24e-82	32	239	18	221	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	1.57e-73	37	239	4	201	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|O97401|GUN_PHACE	3.85e-63	28	238	32	241	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	3.44e-45	28	239	263	500	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999747	CS pos: 23-24. Pr: 0.9716

TMHMM  Annotations     

There is no transmembrane helices in RO3G_00383-t26_1-p1.