CAZyme Information: RL4_JR_10369-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_10369-RA-p1
• CAZy Family: PL3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522		56915.04	5.2242

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000077:10715-12897(+)

Full Sequence      

MTPTTKDTRRTDWKDLNFAGTIDWAVDLQAFGTADTDVPADPPSAGEEGCVAGESADLNT
DELCQFSCNYGFCPESICTCTLRGSVEALPNVVSNADYMAFDEFNPVVNAWDNGLVNADG
SANTTGGLWDKESNYDENRWQCMVFKTPKNRDISVQQCYSNACKAVVDEAVTEGRTSNYG
CVGHWPLDEAIPDLVPDDIKQVFDILSTVADGVSSFKTPMFARGSGKKGDDANPTDRSKP
KKGTGSGAQGTGSSGVTKKYKCNVPAGKTSVIMGEASNTLRLQSCVAAPAAGAGASTTTK
KDYVITSLTFKAQPTTVSRNPSWQALPCVHGNVRNPETDRPGVTAWYNQHDRSWLQKVDR
SQSKCDADEYPPRYLLSRTNPEIVNAGKPGGQLMRYLPNKENEGAGRMWKGVCFAPHLAG
LTPVAFDRKWKAGRNVNRASKAGIDKYQTEVDVDVRPYFAISHFEHAANPPADDGIYDNT
CWPRQKAANDPGFVLFSWDNWYNTHQSLYDFTAPYQQGTNGA

Enzyme Prediction     

No EC number prediction in RL4_JR_10369-RA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	5.49e-05	1	29	317	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT05739.1|CBM18|CBM24|CBM50|GH18	9.73e-109	1	522	867	1520
UKZ57771.1|CBM18|CBM24|GH18	8.92e-105	1	522	844	1500
QDJ94334.1|CBM18|CBM24|CBM50|GH18	1.30e-85	1	521	833	1425
AIT18865.1|CBM18|CBM50|GH18	2.45e-85	1	521	859	1541
CZS72048.1|CBM18|CBM24|CBM50|GH18	2.48e-85	1	521	866	1548

PDB Hits     

RL4_JR_10369-RA-p1 has no PDB hit.

Swiss-Prot Hits     

RL4_JR_10369-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000004

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_10369-RA-p1.