CAZyme Information: RL4_JR_10136-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_10136-RA-p1
• CAZy Family: GT62
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	JACBXF010000145|CGC1	42273.42	7.6996

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000145:24636-26188(-)

Full Sequence      

MCTANCPAQSGNDEGPSKLHERQIEPPIKSRQLHDTIGQLPLRRSLSPSQVLATEVDDNP
YNPSGLNAMHLGLRTRAVGTLCQAGGAVWASDSTEGSGSRGGSGNVNNSSRGSGNGDRRR
VTNVRSVTEPNMSITPASGTLVVGIDNESDAISERKLPIVQKKSGELVWPALRHGSHRRP
SSMPDTLTFSKAVRFDANLEYVRHFLQAEKPTAVSTGSSPVNDSDSESEYSFTMPQSSHA
WTSRHERNAPAKEWEMIASKFPLDTPERKAMAIRLERVWLSADQKSLHGSVAVLNLAFVK
AVVCRFTLDCWKTISEVGAEYSTEILPRTVPQGHDRFSFAVKLSDIADMGTKTMCFCIRY
EVNGKVFWDNNGGNNFLVDFNILPAAG

Enzyme Prediction     

No EC number prediction in RL4_JR_10136-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	272	378	5.6e-30	0.9626168224299065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	3.01e-40	273	379	7	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	2.09e-07	295	376	5	73	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68644.1|CBM21	5.98e-97	16	387	112	445
UPK90335.1|CBM21	7.46e-95	8	380	107	435
CCT66486.1|CBM21	4.12e-92	13	380	105	435
QGI62679.1|CBM21	6.35e-91	13	380	105	436
QGI93572.1|CBM21	6.35e-91	13	380	105	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2M83_A	2.24e-13	268	376	30	131	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]
2EEF_A	1.37e-11	285	378	46	135	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UQK1|PPR3C_HUMAN	1.98e-13	281	378	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q7TMB3|PPR3C_MOUSE	2.67e-13	281	378	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q0VCR4|PPR3C_BOVIN	1.61e-12	281	378	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1
sp|Q5U2R5|PPR3C_RAT	2.14e-12	281	378	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q8BRJ4|PPR3E_MOUSE	6.65e-12	244	376	126	256	Protein phosphatase 1 regulatory subunit 3E OS=Mus musculus OX=10090 GN=Ppp1r3e PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_10136-RA-p1.