CAZyme Information: RL4_JR_10098-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_10098-RA-p1
• CAZy Family: GT57|GT57
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	JACBXF010000100|CGC2	42503.38	5.2269

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000100:61376-62527(+)

Full Sequence      

MAPFYGSSVLSLADDLPSSTVQCHASNLLQLPDGTLLCAWFGGTQEGVSDISIYISQRST
KSLMWSNPVQVSSDETRSEQNPVLFRAPTMGVLWLFHTAQPAGNQDQAVIISRTSTDDGY
TWSTPNNAVNTKRGAFVRQPLVVLADGTWVLPIWYCRTPSGYRWTGSDDVSAVMWTRDKG
ETWHETEVPESVGRVHMNIVPSKDGEGYSAFFRSRWADNIYRSTSRDGIHWTSPVKTTLP
NPNSGIAAAALPNGDLVMVFNDSHAEAGMQRRLDLYDDIRSDDDIRPSQPDTHGLEAIWG
TPRKALSVGVSKDGGETWKYKILEDGSGQCMSNNSKEKVNKELSYPSIVVDPIVGKGIHV
AYTYHRQNIKYVYIEDVEEFVNS

Enzyme Prediction     

No EC number prediction in RL4_JR_10098-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	23	326	8.1e-21	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404074	BNR_2	7.36e-65	34	352	1	274	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
227036	COG4692	1.03e-64	16	372	26	369	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
271234	Sialidase_non-viral	7.50e-43	12	372	3	336	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
226855	COG4447	3.49e-04	93	226	85	209	Uncharacterized protein related to plant photosystem II stability/assembly factor [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI98506.1|GH33	3.29e-154	16	383	10	379
QGI67622.1|GH33	3.29e-154	16	383	10	379
CCT71969.1|GH33	3.29e-154	16	383	10	379
QGI84851.1|GH33	3.29e-154	16	383	10	379
QKD48655.1|GH33	1.89e-153	16	383	10	379

PDB Hits     

RL4_JR_10098-RA-p1 has no PDB hit.

Swiss-Prot Hits     

RL4_JR_10098-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000014

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_10098-RA-p1.