CAZyme Information: RL4_JR_10027-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_10027-RA-p1
• CAZy Family: GT45
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841		91323.60	6.0730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000069:17386-20060(+)

Full Sequence      

MDIEDILKKLTLEEKISLVSGVDFWHTYAVPRLGIPSIRLSDGPNGVRGTRFFGSVPSGC
LPCGTAIGATFDKDLARTIGHFLADEARAKGAHVVLGPTINVQRAPLGGRGFESFSEDPV
LSGILAAKYCRGLEEKGITATPKHFVCNDMEHERMAVDAIVTDRALHEIYLMPFMIAIRE
GNPHAIMTAYNKVNGIHASESHKLLQGILRDSWGFDGLVMSDWFGTYSTSGAISAGLDLE
MPGPSRWRGASLNHSVNANKVSLRTVDDRVRSILKLVRRAVASGIPEHAAETQLNRPEDR
QLLRRVAADAIVLLKNDNRVLPLKTTEAVAVIGPNSKISTYCGGGSASLNPYTAVSPWEG
IQNQAQGPLIFAQGIYGYQMMPPIGRLLKTDDNQVGFTLKIYNEPPTCKSRQLLETRHET
DSNMFFLDYNHPDLNTVWYADAEGIFIPDVSGIYDFGLSVQGTGWLYIDGELLVSNAENQ
RPGSSFLGSGTVEETGHKELVAGKSYRLSVQWGCAKTSALKVAGTIDFGHGGMRISGCLR
LNPTDGIAEAVAVARSVNQVVLCVGLGGEWESEGKDRESMLLPPHTDELATAVLAANPNT
VVVVQSGTPVSMPWLGAAKAVLHAWYGGNETGHAIADVIFGAVNPAGKLPLTFPRRLRDN
PSHLNYRSEGGRCLYGEDVYVGYRFFDEADIEPLFPFGYGLSYTTFSLAALAISREQKDG
MDTSIFHITLTVTNTGSVPGSCTVQLYVLPSQDRVSGVPQRPIQELKDFVKAHNIAVGET
REVALALDAVMATSYWDETADMWCSRKGAYELKVGQSSRDSSALQGTLTVDETTWWTGLK
P

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	242	3.1e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.59e-77	3	820	38	756	beta-glucosidase BglX.
224389	BglX	8.10e-75	23	373	48	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.06e-55	311	703	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	6.64e-53	10	788	60	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.10e-39	32	276	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12335.1|GH3	0.0	2	839	21	846
BCS00565.1|GH3	0.0	2	839	21	846
CAK49185.1|GH3	0.0	2	839	21	846
QQK47512.1|GH3	0.0	2	838	22	847
QMW48789.1|GH3	0.0	2	838	22	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	9.12e-248	2	839	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.45e-242	2	839	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.42e-133	1	820	3	659	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.83e-115	10	831	12	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	3.77e-98	5	831	56	827	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	1	839	4	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	3	839	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	0.0	2	839	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	0.0	1	839	4	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q4WLY1|BGLJ_ASPFU	0.0	3	839	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998358	0.001641

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_10027-RA-p1.