CAZyme Information: RL4_JR_09746-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_09746-RA-p1
• CAZy Family: GT35
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		92200.51	6.1668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000037:249248-251967(-)

Full Sequence      

MTSSNVDVDALLRQLTLDEKILLLAGKNFWQTHAIDRLQIPSLKVTDGPSGARGATFIDG
TPAACFPACVSLAATFDPALARRVGQALAEEALSKGSGVLLGPTVCLHRSPLGGRNFESF
SEDPLLAGVLASAYVEGLQSQRVAASVKHFFANEQDTRRFVLNETISERALRELYLKPFE
IVVKTAKPWTLMSAYPKINGNYVDATAQWLTQVLRKEWGFDGLVMSDWGAASTVACVANG
LDLEMPGPAVHTEPAKVHKALSEGVVTEADINARVRASLVLLERTCKFSDRRDTPEERAI
DRPEHRALIREAGAAGAVLLKNADHVLPIDVRKTSKIALLGPLAKHASTHGGGSSFLTCH
HKISPFEAFEQRFGSSVELSYSKGCEIYRALPDFTEGVTSRDGRPGFDVDYFGSHDGTGP
VLKTQHVHRSYLTTHDQIDIKTAAMSARMRATYRPAVSGRHSLSLSGAGVTTLLVDGQVV
ATQAACIRDAMAFIAGCQDETRAQFDFEAGRAYAIEVLTIMPTVTVSDSPILDKQLCAHV
GFVPEADRERDLLCAAVVAARAADVAIVFVGHTHQWESEGQDMDPAGGMALPPYDTRAQD
QLIAAVAAVNRRTVVVINTGVPVALPWLGDVAAVVQGWYAGQEVGHALVDVLVGAANPAG
KLPMSWPRRYEDSACFGHFGLDALDSCAVTYAEDVFVGYRHYDRHWRGAKEVLFPFGYGL
SYTTFDVRDVRVDGSFSLSAADVVSVSARVQNTGDRAGAETLQVYVVPPVPTPTQLQRPL
KELAGFAKVHLHPGQEDSIRVELDKAAAAYWDEGIHQWKVLAGSYTILLATSAHPDSVQG
QGTVQVPEDFVFGP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	246	8e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	7.59e-68	27	387	47	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.72e-52	8	812	38	734	beta-glucosidase BglX.
178629	PLN03080	1.75e-37	10	839	55	778	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.57e-35	569	699	97	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.93e-34	37	276	63	311	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02780.1|GH3	6.13e-281	1	853	1	827
BCS18431.1|GH3	2.27e-237	8	846	11	838
EAA65189.1|GH3|3.2.1.21	1.87e-233	8	832	11	826
ABF50843.1|GH3|3.2.1.21	1.87e-233	8	832	11	826
UPK99435.1|GH3	5.47e-227	4	848	2	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.74e-164	4	833	2	825	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.73e-158	4	833	2	825	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.04e-126	6	850	3	678	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.06e-104	15	833	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.20e-100	8	854	4	721	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	3.31e-234	8	832	11	826	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	5.83e-180	8	854	2	818	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	4.66e-178	7	829	5	815	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	5.16e-177	6	829	4	815	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	3.18e-175	6	829	4	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000022

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_09746-RA-p1.