CAZyme Information: RL4_JR_09459-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_09459-RA-p1
• CAZy Family: GT3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835		90111.50	5.0637

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000158:231791-234420(-)

Full Sequence      

MADIDVEAVLGQLTDREKVSLLAGVDFWHTKALPKHGIPSLRLSDGPNGVRGTRFFNSVP
SACFPCGTALGATFDTALLREAGALMAEEAKAKGAHVLLGPTINMQRSPLGGRGFESYSE
DPVLAGLAAAAVVQGIQSGNVAATVKHFVCNDQEHERNRVNSIVTERALRELYLLPFQLA
IRDGQPKALMTAYNKVNGVHASENKKLLADTLRGEWGWKGLVMSDWYGTYSTSEALDAGL
DLEMPGPSNWRGDAANLAEATYKLAPTTLNDRTRAVLELVKQAHASGVPENAPEGTRDTP
ETAALLRRLAADSVVLLKNEGVLPLNKSKKQTLVIGPNANTATYCGGGSASLRPYHAVTP
LDAIRDKIGSDNVEYTVGAYSHKDLPDLGPQLSTTAEGGKEGVTFLVYNEPPEAKERHEL
DRLEFETVNLMFMDYKDDKRNELWYADIDGYLVADRSGPFEFGICVYGSAQLFVDGKLVV
DVTEKQTQGTSFFGCGTTEEIAAVDLEKGRTYHVQVRFGSAPTTKLTPQAVAFGGGAVKV
GGAWKIDEQAEIERAAALAGQHDQVVVVVGLNKDWESEGFDREDMKLPGRLDDLVAAVSA
ANPKTAVVVQSGTPVELPWRAGAGALLQAWFGGNETGHGIADVLFGDVNPSAKLPLSFPE
RVEHNPAYLHYRSEAGRVLYGEDVYMGYRYYDTIGLPVAYPFGFGLSYTRFAVSDLKVDL
ADSTLKAAVTLANTGDVDGAEVLQLYVSQTAPSIRRPAKELKAFQKVTVAAGQSAQVTLS
APLKYAASYFDERKNQWIVEAGEYTAYVSTSSKLEEGNHVAATFTVPTTFWWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	245	1.2e-68	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.45e-76	64	813	120	755	beta-glucosidase BglX.
224389	BglX	5.50e-68	26	375	48	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.83e-54	314	708	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	3.87e-44	8	794	55	756	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.85e-33	64	279	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD50485.1|GH3	0.0	5	835	6	833
ATZ56815.1|GH3	0.0	5	835	6	833
UQC84651.1|GH3	0.0	1	835	1	833
QSZ32943.1|GH3	0.0	4	835	5	834
CEF74963.1|GH3	0.0	1	835	1	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.01e-266	1	835	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.53e-259	5	835	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.75e-131	4	813	3	658	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.79e-119	10	813	9	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.63e-102	6	813	4	703	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	7.79e-305	1	835	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.61e-303	1	835	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.24e-303	1	835	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	7.24e-303	1	835	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	3.59e-302	6	835	14	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999898	0.000118

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_09459-RA-p1.