CAZyme Information: RL4_JR_09076-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_09076-RA-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1047		111399.56	4.9786

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000053:355791-358974(-)

Full Sequence      

MDLALFLLSLLCVGAHGLGQTPILSWEAVDDGLPIVGDAAPVRGQIRVSPDDYWGVIRAA
GDLAADFGRATGTNLTLSNGVAGALPAAYAYQPVDNLNNTVYRTTGNASFAGPAYADPVP
ADTVILAGTLGRAPAIDALVAAGRLNVSAVSGRWEAFVSALVEAPLPGCARALVIAGSDA
RGTIYGLYDVSEQLGVSPWHFWADVPVARRPTVWVRAGPKVQKSPSVRYRGLFLNDEQPA
LTGWVASRWPDAGPYGDAGYGADFYALVFALLLRLRANYLWPALWGAMLAVDDPANQPLA
DAFGIVLGSSHTEPLLRAQNEFGKFYAGAWAYDQNNATIDDYFRYGVQRARPYADNALWT
VGMRGSGDTAIEGLGTAAIVSLLTTLVANQRAILASGLGVADVATVPQLWCLYKEVQSYL
DAGLAVPDDVTLLWSDDNWGNLRRLPRADEQARAGGAGVYYHFDYVGDPRSYKWINTIQL
AKTAEQMGLALARGADRVWVVNVGDLKGLELPLAHFLDLAYDADRWAGVAGTAAWAEAWA
AREFGPWSGNATQIADLVGRYGVLAARRKFELLEPQTYSVLHYGEADAVLAQWAALVADA
QAAYDALDAAAQPAFFETVLHPALAGAVVHRIAIGAAYNQLYAGQKRNAANEVIRDLLQA
SAEDANLTARWDALLGGKWAHMMDQTHLGYDGYWQQPMRNTLPPLTFVQTAAASLAGHVG
VGVEGSNATVPGDDPWHTNSVNTLFTPPLEPYGAATRYFDVFSRGTRACVWTASVAEPWI
HLSQTTGTVGGSDAPDTRVYVSVTDWTLARTTNVTINVTTPCRGTERYGYSAPVVRVPVV
VRSVPADFVGFVESDRTVAIDGPHYQAIVSSGHDGSLTYQTLGPHYGRNGSGGVTLYPLG
TEKRTVATAPALEYRLYLFSNRTANVTVLLSPAQNYLGDNDPLAYAVALYPSVGTASEPV
LVEPVGASVGASMPSGWGYAVGDSAWGVTGNKTTTSFALAGGVAAGTAYTLRLWLLLPGI
VVQKIVVNLGGVRPSYLGPPESFLAGQ

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	45	708	9e-220	0.8350071736011477

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	1.08e-180	223	572	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	8.07e-49	850	1041	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO59811.1|GH115	0.0	18	1047	21	1063
EAA30769.1|GH115	0.0	18	1047	21	1040
AEO68188.1|GH115	0.0	18	1047	21	1051
VBB82023.1|GH115	0.0	15	1047	51	1077
CAP65960.1|GH115	0.0	17	1047	75	1099

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	3.20e-171	46	1047	25	938	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	1.57e-116	125	725	96	682	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	3.03e-116	46	719	28	661	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.19e-114	46	719	27	660	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	9.85e-112	125	1047	65	968	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

RL4_JR_09076-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999713	CS pos: 17-18. Pr: 0.9840

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_09076-RA-p1.