CAZyme Information: RL4_JR_08874-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_08874-RA-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	JACBXF010000164|CGC1	91155.85	5.3128

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000164:548959-551659(+)

Full Sequence      

VSLMTAADFWRTKSISAKGIPSVKTSDGPNGARGSIFVGGTKAALFPCGISLAATWNKDL
LYNVGQRLADEVKARSAHVLLAPTVCLHRHPLGGRNFESFSEDPLLTGKLAARYICGLQS
KGVAATIKRAHHSTDFVGNEQETNRMTVNSQIAERPLRELYLRPFEIAVREASPWAVMTS
YNLVNGVHSDMNPFTIRDILRREWGYDGTVMSDWDGTNSTVEAIKAGLDIEFPYSTKWRL
YKVLQAVKDGKLSTEEIDQAAENILTLVQRVRGDDTSEEPPEREDDQVDTRELIREAGVQ
GITLLKNENAVLPINPKTAKVAVIGPNANRAIAGGGGSASLNPYYNTLPLDSIRQAVAAA
GEEAAETKVSYAVGCHIDKWLPVASPFCTTTADNGVSGVTIKWFAGDRFQDDPVVTQRRL
NTDLFLWDSAPLDQVGPEWSAVATTYLTPQTTGRHTISFMSVGPGRLFVDGKLSLNLWNW
TEEGEAMFDGSVDHLVEVDMEAGRPVELRVEMTNELRPLCKQKQHNATHRYGGCRIGFKE
EDKTDYLREAVEAAEAADVAVVIVGVDAEWESEGYDRKTMDLPLDGSQDRLIEAVVAANP
RTVVVNQSGSPVTMPWVDRVPAIVQAWYQGQEAGNALADVLFGCANPSGKLPCTFPRQIE
DAPAYHNWPDENLEVIYGEGLYVGYRHYERAKIAPLFPFGHGLSYTTFEYGRPSISRRTL
SSAAGSSIEIIMAVSNVGLVAGAETVQVYVHDVKSRLPRPDKELVAFDKVFLEAGETQHV
RLRLDKYAVGYYDTAIRHWIAEAGVFQVLLGASSADIRHVPLRCSGSGLTV

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	14	232	2e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.37e-79	46	819	120	759	beta-glucosidase BglX.
224389	BglX	4.32e-71	8	339	48	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.83e-52	302	685	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.14e-40	19	267	65	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.12e-38	1	785	57	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO53892.1|GH3	0.0	1	819	69	870
CDP23238.1|GH3	0.0	1	820	94	897
CAP69216.1|GH3	0.0	1	820	94	897
VBB72333.1|GH3	0.0	1	819	94	894
AEO66128.1|GH3	0.0	1	819	72	874

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.89e-176	1	820	19	831	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.58e-171	1	820	19	831	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.20e-139	3	817	20	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.20e-118	2	820	19	658	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.86e-106	12	818	43	706	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	4.34e-217	1	817	24	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	3.81e-190	1	822	15	812	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	6.12e-189	1	822	27	853	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	9.02e-188	1	817	19	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	3.47e-187	1	817	19	822	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_08874-RA-p1.