CAZyme Information: RL4_JR_08376-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_08376-RA-p1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570	JACBXF010000002|CGC11	63902.09	6.1935

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000002:644333-646202(+)

Full Sequence      

MKTYLYEALFALAIAPVWAKPFLQEGSGNTWIIGNDLWNLTQGTQYATSLYYNGKDLVGN
ASGHYTSSSPTADYNWTSAAIVNENTKNRDGFIDIKFASRDAELHWVIFDGLAGAYQYIV
NVNLPTITEFRTVWRLDNSTFTHVKTPSRQEELPPLAWFPAGKQIQDETWERPDGKGYLT
KYNYADFVRSTKYYGVYGNGFGSWYIRPGNDYLNGHHLKQELMIHRETKTGDVVLLNMLQ
GSHFMIQQGSQLNAPAGRVWGPWLWYLNDGSIPDVQNRVDREANSWPYAWLQNSLYQSRG
GVRGRLRLSDGRAASGAAVYLGDNNPTNPYSLYMGSRYTYTAYTDLNGYFEIPHVHVADS
PFSLQAWSNGTEIGDVDTTFLKNDVAVVKGETTNLGDLEWAISKRARIFQVGDFDRLGRG
FAYAGSLRRHGASDDCPADIEFVVGQSSVSDWCYAQAKQGTWTIRFDIKSSRGSFPEQAV
LIVSLAGYSTGTDATVSVNGNQVSTLKGGTAGLLGDQSVYRSANLAGEWRKFEFNFNTTI
LEEGSNKVEFSVTKSARWRGFLWDSIILEW

Enzyme Prediction     

No EC number prediction in RL4_JR_08376-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	32	555	2.3e-203	0.9922928709055877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	1.65e-48	27	274	6	263	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405384	CBM-like	3.58e-37	407	568	1	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
199905	RGL4_C	3.94e-25	409	569	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	4.67e-13	298	398	1	92	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
404503	CarboxypepD_reg	2.05e-04	301	395	1	77	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19874.1|PL4_5	9.77e-215	21	570	29	572
AEO65538.1|PL4_5	7.94e-212	21	570	28	574
UQC83548.1|PL4_5	1.34e-209	7	566	120	703
CAE6996798.1|PL4_5	8.20e-179	4	569	6	563
CBY02118.1|PL4_5	7.45e-176	20	569	30	569

PDB Hits     

RL4_JR_08376-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RJP2|RHIE_DICD3	7.22e-57	92	548	113	557	Rhamnogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=rhiE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999776	CS pos: 19-20. Pr: 0.9823

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_08376-RA-p1.