CAZyme Information: RL4_JR_08251-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_08251-RA-p1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823	JACBXF010000002|CGC1	92659.46	4.6653

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000002:301036-303605(+)

Full Sequence      

MASIRQLALSLSLASAGLFAPGTEAQAAESPLYSELARQNNQSLLWGPYRPNLYFGTRAR
IPKSLMTGLMWGRVDTYTELDNYIRYTCEQNEGMAGYGWDEYDARRGGIQTIHDAGNSLD
ITTSFVKVPGPNGGSWAVRIKGELREDAAPDMKTTVVYYVSQEEEGATLEVAPDPLSSDD
ASMGFGGDVTLQGRSPALGRYKLVVTKGTGEHPTSDHAFSAERDLSKTTVQSLTAPEEHI
WQAKPLVFRQFKESVDHVISKYDPNDAPPPWQLYQLQNRPGSGNVHIVQKMFEGPFEFDV
LYSSLPDESDSDDGKELTSDDLTRAIAETSKAFDEHFASSFVLQAPYTADAYQPFARSMF
SNLLGGVGYFYGQGIADRSYASEYEEEDEGFWEEAATARARHQEKLDGPYELFTSVPSRP
FFPRGFLWDEGFHLFPIADWDLDLTLDIVKSWFNLMDADGWIAREQILGSEARSKVPPEF
RVQYPHYANPPTLFFIVDLFADKLRAAGSGSKNSSSEPLATAFVDNPEAGLEFLRNLYPR
LRLQFDWFRKTQKGDIKSYEREAFSSREAYRWRGRTEQHVLTSGLDDYPRPQPPHPAELH
VDLLSWVGLMAKTLINVANLLGLSEEKAPLATIYEAITRNVNDLHWSEAEGCYCDATIDD
YEENKLVCHHGYISLFPFLTGLVQADDPKLGRILALLGSEDELFSPHGLRSLSKKDEFYG
TAENYWRGPVWMPLNYLAVVQLYKTATQDGPYRAQAGDLYNRLRRNLVDTVFKSWQETGF
AWEQYNPDTGAGQRTQHFTGWTSLVVKLMTMPELPGGRIKDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	597	809	6.1e-30	0.43333333333333335

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	317	811	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.78e-106	44	269	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	9.59e-11	462	756	304	558	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
395961	Trehalase	2.07e-04	601	792	305	480	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
236653	PRK10137	8.40e-04	601	803	578	773	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ERS95155.1|GH63|3.2.1.106	0.0	1	823	1	829
AFP89323.1|GH63	0.0	44	823	1	786
AEO63368.1|GH63	0.0	1	823	1	831
AEO56870.1|GH63	0.0	1	823	1	838
QBZ64685.1|GH63	0.0	12	823	14	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.46e-173	35	809	6	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.62e-128	44	809	37	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	4.97e-221	35	810	33	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	5.14e-173	33	809	34	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	3.00e-128	44	809	92	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	6.28e-127	46	809	94	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	2.24e-123	44	809	94	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000568	0.999395	CS pos: 27-28. Pr: 0.9539

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_08251-RA-p1.