CAZyme Information: RL4_JR_08013-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_08013-RA-p1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	JACBXF010000003|CGC6	35736.22	4.7513

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000003:888476-889533(-)

Full Sequence      

MPERSIESQQEPLLGSATAEETAEEMGIDIEALRFWGRHGQDASSTSSQPSLDEKHQTDG
RTVSLLHPRTWTRKMIIIAVALVALICIVPAIAVPVALSVSTAAPDALLGNGTALRVMPL
GASITYGYRSTDGNGYRYTLRTLLTSRGNAVNMVGSRQNGTMDDNDVEGWPGLRIDQVLT
KAQANVSVSSLLPNIVLINVGTNDCLQNFNVSGAADRLRTLVTDVRALSPKAAFVLSTLI
LNTDSTVDARVQTVNAGIRTLVTSLQSTGFPIVLAEMHGDNGPQTSEMVDQTHPNDTGYA
KMGTIFNTAMQEVSDRGFIQAAENNGLPDNGATTQ

Enzyme Prediction     

No EC number prediction in RL4_JR_08013-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	115	309	4.1e-60	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	4.56e-48	115	310	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.83e-15	120	301	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.26e-14	120	306	4	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
239947	SGNH_hydrolase_YpmR_like	2.49e-10	120	304	5	199	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
395531	Lipase_GDSL	7.37e-09	117	303	1	221	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66483.1|CE0	1.33e-71	109	332	37	261
CAP71774.1|CE3	1.17e-66	109	331	54	279
CDP31165.1|CE3	1.17e-66	109	331	54	279
QPG99528.1|CE3	1.55e-63	106	321	36	250
AEO60969.1|CE3	3.16e-62	94	332	22	299

PDB Hits     

RL4_JR_08013-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	2.07e-09	97	303	22	253	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000002

TMHMM  Annotations     

Start	End
76	98