CAZyme Information: RL4_JR_07958-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_07958-RA-p1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	JACBXF010000003|CGC4	44151.47	7.1333

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000003:748092-749320(+)

Full Sequence      

MSPTRGRTASGNSSSSSLSGQNNSSSHGRSRNGYKPIFDEERLEWEAAPRWSMWPRRLRF
PRLRMRKKTVGLFLFDLIVTVLVICAFEPLITLLVRNEEMFGARLTFTNSTAAPYNASSS
ANPIPRIFHQTSATFDIPERWVASRQSCKDAYADFEYMQWTDELAREFISAEYPWFLDTW
DNYPFPIQRADAIRYFVLYHYGGIYLDMDTICNRTIPFDQIEADGAEHHAVFVSTKPTGV
SNDMLISSSHHPLFAAAIAQLLFFNEITQKWARFQPHTAVMISAGPFFLTMTIKDYLFAQ
PSLSSPTVSVVNSTQLSPYITDLEDCSWHRNDTKALMWIGDHPWTWFLMGAIGLAIGLHL
VNHGLLLALKGMDKLVTVTHEMKVAKVL

Enzyme Prediction     

No EC number prediction in RL4_JR_07958-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	140	216	4.9e-23	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.36e-40	72	348	38	299	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.56e-26	138	217	1	84	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95791.1|GT32	2.81e-160	38	386	29	383
QKD62461.1|GT32	2.22e-141	35	362	12	334
SCB65856.1|GT32	5.54e-138	28	362	8	337
QPC71180.1|GT32	5.54e-138	28	362	8	337
QPC59875.1|GT32	5.54e-138	28	362	8	337

PDB Hits     

RL4_JR_07958-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	3.36e-48	65	352	1	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.11e-46	116	342	74	295	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	2.31e-46	124	352	62	283	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	6.38e-43	118	291	51	213	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	9.11e-37	108	339	52	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000001

TMHMM  Annotations     

Start	End
69	91
344	366