CAZyme Information: RL4_JR_07792-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_07792-RA-p1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686		75384.44	5.2468

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000003:248925-251088(+)

Full Sequence      

MAARALAAALWLVPAAALFTNGSVIAPCDSVLYCHGDILKAIELAAPFTDSKTFVDMPTV
RPLNEVVAAFEKLSKPVTNNTELNAFLSTYFTAAGGELESVPTTELTTNATFLDKLNDTV
LHQFVGKIIDIWPDLTRRYTGGSANTSCAGCVSSFVPVNRTFVVAGGRFREPYYWDSYWI
LEGLLRTGGSFVDISRNTIENFLDLVDQYGFVPNGARVYYLNRSQPPLLSQMVRAYVAHT
GDRTILDRALPLLVKEHAFWTVNRSIEVTGPDRQNYTLSHYSVLNNQPRPESYREDYISA
NNHSYYASSGIIYPETKPLTDDEKAALYAQLATGAESGWDYGSRWLARPNDAAKNVYFPL
RSLNPNNLLQVDLNSILYWNEVTIAGFFNTTGNATAAAAWSDLAKARSDAMFALMWNATL
WSYFDYNLTSGTQNTYVPLDDDATPAETANAPAGSQVVFHVAQLYPFWTGAAPERLKNNP
LAVKQAYQRVATLLDTKAGGIPATNFRTGQQWDEPNVWPPLQHVLMQGLLNTPPTFGADD
QDYQDLQTLALRLGQRYVDSAFCTWYATGGSTTETPQLAGLTAKNVGTMFEKYADNTTNG
AGSGGEYTVVEGFGWTNGVLLWTADTFGSRLTRPNCGNITAAKVNSAKRRRENTASDDAG
PWSLPPSAVYLRAADAAWVKKFGSRA

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	48	625	2.8e-153	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	4.93e-130	48	628	3	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.06e-123	32	625	12	549	alpha,alpha-trehalase
224541	TreA	3.08e-79	33	633	56	558	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	1.36e-75	37	633	51	542	alpha,alpha-trehalase TreA.
237326	treA	3.08e-65	36	621	49	530	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO70020.1|GH37	0.0	15	686	19	680
AAN38003.1|GH37	0.0	17	685	22	679
QBZ56021.1|GH37	0.0	17	685	22	679
ATY63688.1|GH37	0.0	3	686	8	672
AEO53147.1|GH37	0.0	15	683	18	676

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	2.56e-64	50	628	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	3.48e-63	50	628	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	2.02e-59	36	643	15	516	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	6.88e-57	36	643	15	516	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
5Z66_A	2.27e-56	36	625	52	537	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	1.41e-111	18	636	39	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	1.45e-100	27	632	24	552	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	3.72e-99	27	632	27	555	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|P19813|TREA_RABIT	1.26e-98	27	632	27	554	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|A8J4S9|TREA_APIME	1.74e-97	19	632	32	573	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000512	0.999459	CS pos: 17-18. Pr: 0.8941

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_07792-RA-p1.