CAZyme Information: RL4_JR_06637-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_06637-RA-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278	JACBXF010000155|CGC7	30398.34	6.2194

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000155:1692069-1693141(+)

Full Sequence      

MVAVFVEDEGRQCSALARSAIRLGFHDAGAWNTSLVMPAEVEADVASGRHGWGGADGSIV
LLPEELRRRENWGLEDVAHLLRGWYDDLNTHHHNAVSMADLIQMAAIVATVTCPGGPRIR
AFVGRRDVKPGAHPPPPLDLMPKPSHDTDTLIRMFAAKTLSATDLVALVGAHTVSKQFHV
DVDRAGYPQDTTHGLWDTRFYAETADVQPPAGIYRFESDVALSQATATRALWMRFSGSQR
AWLEEAYAPAYFRLSLLGVQNLNDLTDCSGVLPPARHA

Enzyme Prediction     

No EC number prediction in RL4_JR_06637-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	9	259	7.2e-52	0.9411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	1.96e-85	10	275	31	290	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173823	plant_peroxidase_like	4.15e-29	6	255	7	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	3.44e-27	19	238	18	187	Peroxidase.
173825	ascorbate_peroxidase	7.64e-21	21	259	34	250	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173829	plant_peroxidase_like_1	4.75e-14	10	174	38	171	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI65955.1|AA2	1.34e-75	8	273	107	351
AEO59029.1|AA2	6.45e-73	1	273	110	359
QRD06638.1|AA2	1.18e-70	1	276	110	362
UNI21317.1|AA2	3.49e-69	12	273	108	349
CAE7175176.1|AA2	2.33e-67	1	276	109	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q3U_A	1.23e-31	10	273	32	289	Trametes cervina lignin peroxidase [Trametopsis cervina]
1LY8_A	7.09e-31	9	275	38	299	Chain A, Peroxidase [Coprinopsis cinerea],1LY8_B Chain B, Peroxidase [Coprinopsis cinerea]
1B80_A	5.93e-30	10	276	38	300	Chain A, PROTEIN (RECOMBINANT LIGNIN PEROXIDASE H8) [Phanerodontia chrysosporium],1B80_B Chain B, PROTEIN (RECOMBINANT LIGNIN PEROXIDASE H8) [Phanerodontia chrysosporium]
6A6Q_A	5.93e-30	10	276	38	300	Chain A, Ligninase H8 [Phanerochaete chrysosporium RP-78]
1B85_A	8.24e-30	10	276	38	300	Chain A, Ligninase H8 [Phanerodontia chrysosporium],1B85_B Chain B, Ligninase H8 [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20013|LIGC_TRAVE	5.71e-33	10	273	58	319	Ligninase C OS=Trametes versicolor OX=5325 PE=1 SV=2
sp|C0IW58|LNP_TAICA	5.72e-29	46	273	61	290	Low-redox potential peroxidase OS=Taiwanofungus camphoratus OX=2696576 GN=LnP PE=1 SV=1
sp|P28314|PER_COPCI	1.38e-28	9	275	58	319	Peroxidase OS=Coprinopsis cinerea OX=5346 GN=CIP1 PE=1 SV=2
sp|P49012|LIG2_PHACH	1.56e-28	10	276	59	321	Ligninase LG2 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG2 PE=1 SV=1
sp|P06181|LIG8_PHACH	1.59e-28	10	276	59	321	Ligninase H8 OS=Phanerodontia chrysosporium OX=2822231 GN=LPOA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000002

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_06637-RA-p1.