CAZyme Information: RL4_JR_06585-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_06585-RA-p1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	JACBXF010000155|CGC2	52434.56	9.8042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000155:1558673-1560213(+)

Full Sequence      

MAPSPAAQQKTQPPPSSAAPEQKEPGVVAGAFFGSASAVYGAAALLRVVLLVYGLWQDAH
SPVKYTDIDYLVFTDAARFVARGQSPYARETYRYTPLLAWALTPAGSGGSGGSGWTEQAL
FASGKVLFAAADLLAGWLLERVLVQQQLAAAAPGPRKISGAAAAAADRARARLYASVWLL
NPMVAAISTRGSAEGLLGALVAALLWAVLVARRPLVAGVLLGAGVHLKIYPFIYAPAIFW
WMDGDDGSDDERIGSGRRPKAKPASQSLQSALAAFLTPARLQLTAASLSTFLGLNAVMYS
IYGFPFLQHTYLHHVTRIDHRHNFSPYNTQLYLSSSHAAGSTVGLSSSSSLSSSSSSSSS
LGLPVESVAFLPQLLLSTVLLPLVMAKKDLATTMLAQTFAFVTFNKVCTSQYFLWYMVLL
PAYLPRSSLVRNPRRGAAALALWVAGQAAWLQQGFALEFLGQSTFVPGLWVASIAFFLVN
CWILGVFIEDVV

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	187	488	4.6e-92	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.00e-80	42	488	14	415	GPI mannosyltransferase
252941	Mannosyl_trans	4.76e-65	187	488	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81264.1|GT50	5.02e-175	39	491	34	442
QBZ54528.1|GT50	6.19e-175	35	492	24	428
CAP65259.1|GT50	2.88e-174	39	491	34	442
CAD60578.1|GT50	2.88e-174	39	491	34	442
CDP29471.1|GT50	2.88e-174	39	491	34	442

PDB Hits     

RL4_JR_06585-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7S4Z3|GPI14_NEUCR	1.90e-173	39	490	29	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	2.23e-164	35	491	7	421	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	3.87e-162	39	491	11	428	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.75e-160	37	490	11	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	2.23e-159	37	491	9	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999949	0.000075

TMHMM  Annotations     

Start	End
192	211
218	240
285	307
398	420
466	488