CAZyme Information: RL4_JR_06568-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_06568-RA-p1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287		30586.52	7.9227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000155:1510856-1511943(+)

Full Sequence      

MASLRSLSLLLLPLVAAQKCPLQFDGRVPAGTTLASFDSTNKLFNSANVFGKNLSFSQLL
KLPTVNGSLFDTTTLPLEVTIDDKSIFAPSATNIQTGFRRAELLPASNNGTDPSTKGVKT
LHFSLQKDAQRPLNLTHEYQLVFLESADFSTNQFVLKTGTIIGSNSTNSSGTLQLFANVN
KSPSKVLFSTPFTAGVFHNFAVTLNFNNLTTQVFYSTGKTALKSVTQAVSNDVSGQGQFH
FGLLKKPIGGGSDIVHNGFQESGINEGIIYGGIFEEDSSAGCVSLSA

Enzyme Prediction     

No EC number prediction in RL4_JR_06568-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	24	282	4.4e-79	0.9686274509803922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	3.79e-92	22	281	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC91294.1|GH131	1.83e-122	16	286	95	364
VBB76803.1|GH131	1.77e-111	15	285	17	274
AEO64872.1|GH131	3.99e-109	6	286	10	277
QBZ65172.1|GH131	1.40e-108	15	287	20	294
CCD33609.1|GH131	2.44e-106	3	278	5	283

PDB Hits     

RL4_JR_06568-RA-p1 has no PDB hit.

Swiss-Prot Hits     

RL4_JR_06568-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999698	CS pos: 17-18. Pr: 0.9653

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_06568-RA-p1.