CAZyme Information: RL4_JR_06365-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_06365-RA-p1
• CAZy Family: GH37
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627		70079.25	5.5920

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000155:824727-826937(-)

Full Sequence      

METEDPAAVVQDVIRTQRTLFKDIYGQEHAVPQLLALYKEVQQQYESGKLQVPDDVTLLF
ADDNFGTIRRLPCGDEAKRKGGAGGKTWHQLQQAYHKGARQVWVFNVGDIKPQEVPLTMA
LSLTYDIQSVQSDGLGTFLDETATKWFGPALGPDIASSWLGYDRLVSLRRHEHMEPASFS
PIHYEEAETILTRWDSLHASTEAIYARAPAELQPALFQLVTHPVKASHIFTSLQILLDRN
QTHALQRRNTTNALAQRVLRLFDADFSLSEEYHTMLDGRWRHIMAQPHYGFGDTWHAPSR
DMISGLCYVQQRQNSNPIVGQMGVAVEGHVGVRPGRTNEESDRTHPSRKDLVPGLTLPPL
TRYGPGRRYFDIFTRGSVSLDWHAGAPHDWVQLSVAQGVLDPLGEDVRVYVSIDWDAVPP
DFDEEVLVDIRSNLGDLEHVHLPVLSRLVPVPAGFASGFVEGPGYLSIPASKGVVAEQSY
IILPDAGRTEEGSLVDPKLLLPFLVHNVWVFSKARDPVSVALYFNMTLDTDPAHPMVYEL
AIDDAAETSHRLVSPPTEKGLPEGWFTAVQDCVWLHKHEFSPDVLTPGQHKLKIRLLDSN
ILLEKIVIDFGSVADSYLGPTPSHWIP

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	4	308	2.2e-90	0.46628407460545196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	1.73e-70	1	173	140	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	6.22e-49	458	622	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60925.1|GH115	7.17e-253	1	626	321	989
UQC84413.1|GH115	6.79e-250	1	626	318	997
CCT74251.1|GH115	1.70e-232	1	620	316	963
QKD61101.1|GH115	6.83e-232	1	620	316	963
AAO27748.1|GH115	4.52e-230	1	623	316	967

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	4.76e-76	9	623	310	933	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	2.49e-41	4	626	318	966	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
7PXQ_A	7.14e-29	4	291	322	631	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	7.15e-29	4	291	323	632	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	6.56e-26	9	362	343	722	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]

Swiss-Prot Hits     

RL4_JR_06365-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_06365-RA-p1.