CAZyme Information: RL4_JR_06268-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_06268-RA-p1
• CAZy Family: GH37
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	JACBXF010000155|CGC1	43386.08	6.2385

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000155:528610-529838(+)

Full Sequence      

MLTFRRALLAAACVLTIIFLTTHTHTSRDLLKGSQSAAASADRIASEVAGAVPAKDAYTT
TAADSGSSRRPASGSGAQSSSKPSGAAAGSGQKTMQPPPDLSKLSLYDKLAYQFPYDVDS
KFPAYIWQTWKFTPANQEFAFRDQEATWSEQHPGFIHEVITDAVAVKLLRLLYASVPEVL
QAYDALPLPVLKADFFRYLILLARGGIYTDIDTYAIRSALEWIPESVPREAVGLVIGIEA
DPDRPDWHEWYSRRIQFCQWTIQAKPGHPVLRQIVSHITTETLKRQRNGLLQNLDKSVVE
FTGPAVWTDTIFDYFNDDRFFDMSTSKGAIDWNNFTGMTAPKRVGDVIVLPITSFSPGVA
QMGAKDYDDPMAFVKHDFEGSWKPEAERHVG

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	145	225	7.4e-19	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.00e-44	96	383	54	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.31e-19	147	226	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65877.1|GT32	5.65e-191	1	391	1	374
AEO65653.1|GT32	6.99e-182	1	391	1	379
VBB72967.1|GT32	5.13e-181	91	391	74	375
CAP67577.1|GT32	1.60e-175	96	391	79	396
CDP23838.1|GT32	1.60e-175	96	391	79	396

PDB Hits     

RL4_JR_06268-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	5.23e-95	99	388	78	385	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.32e-80	108	383	130	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.53e-72	92	388	103	395	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.01e-71	105	391	79	478	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.649342	0.350651

TMHMM  Annotations     

Start	End
7	26