CAZyme Information: RL4_JR_05705-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_05705-RA-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		43491.15	9.0536

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000142:1877985-1879238(-)

Full Sequence      

MARFLIALALALPVIAVPVGTEPESVDVLNPANYLLLPPSLNVSLDAMLDPLANTTGSAA
VLDAADAFADISSYVLPHIFEAGDLDEDADEPVLRSRGIISWVGKQASKAKAGLKKLTSN
GNQTPNNGTMTNSTTDLLVKPKVRPTKNPSVLHEHLIDIIARIVRHSPVGVTVRTFTKML
KSIGTRIAVRAHVPINENGLMTTLPSSNAPLNMAGPMGTSPCADVALLFARATAEPGNVG
LLVGPALIAAVRERLPYVLGAGASLAVQGINYKAGVVGYLRGGDSKGAETVAELVRGTST
RCPNTRIVLAGYAQGAMVMHRAVRMLSKNNTTSTATAPISAALLIADPRNGQALPGIDVD
RTLVICHRYDSICHGKDRITGAHLTYAHHVGPAADFILSTVAADLAKANSTAPTTTA

Enzyme Prediction     

No EC number prediction in RL4_JR_05705-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	221	399	3.5e-37	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.32e-37	221	399	1	171	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ53617.1|CE5	8.39e-43	221	403	41	213
QSZ35346.1|CE5	1.30e-39	187	403	39	243
AGO59082.1|CE5	1.54e-39	222	399	31	198
APA05756.1|CE5	1.05e-38	227	402	3	169
ATZ57773.1|CE5	3.17e-38	213	397	19	196

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	1.93e-33	221	401	78	247	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
5X88_A	1.45e-22	221	397	22	194	Chain A, cutinase [Malbranchea cinnamomea]
3GBS_A	2.45e-15	221	399	20	194	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
4OYY_A	3.14e-15	222	397	17	188	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
3QPD_A	3.72e-15	221	399	11	185	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00298|CUTI_BOTFU	5.64e-39	213	397	19	196	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q9Y7G8|CUTI_PYRBR	3.38e-36	222	396	32	196	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1
sp|A8QPD8|CUTI1_TRIHA	1.64e-33	222	397	79	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	8.57e-33	221	401	78	247	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2
sp|A0A024SC78|CUTI1_HYPJR	8.57e-33	221	401	78	247	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999791	CS pos: 16-17. Pr: 0.9447

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_05705-RA-p1.