CAZyme Information: RL4_JR_05682-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_05682-RA-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		61522.33	6.5623

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000142:1806235-1807911(+)

Full Sequence      

MEGMSDSGPLVRWQLVCPARRRGDEDACAKDLEAVTAPLDRPEPPDQQPTTELDSRCLAE
ASAAWYPPPSSSLQDSLFRPPRDLLALALRALHNAWPARAPALLPGPLLDIDPPPPPPSP
LLPVSTHSPPLTASAMLVRMQRNSAGVLAVVAVLVLGALVHYLWQSEVALSAPWVPDAGA
IRFADKPLAPPDPRMLIGEYALPLRTRGRDIVDARGRRFKLASVNWYGASDEHFVPGGLD
VQHRDVIAQTIRRLGFNSVRLPYADEMVMANPAIPAARVAANPDLAGLPALDVFAAVVTA
LTEAGLAVIVNNHITAATWCCGADPCDAGWANDHLPVQLCRVRQSEDEWIAHWQTVMRRF
VDNPRVIGADLRNEVRGLWGTMPWARWATAAERCGNALLRLDPRWLVIVGGTESGNDLTG
VAARPVILDVPHRVVYSAHVYSWSGWGSREGRFAQRSYASFVRAMRRSWAYLVEEDRAPV
WIGEFGAPHEPSVGDANYWKHLLRFLAALDADFGYWAINPRKPAANAVETYALVADDWRT
PVLDYRMRDLSELMRLHQ

Enzyme Prediction     

No EC number prediction in RL4_JR_05682-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	211	524	1.6e-153	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.58e-26	247	520	29	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	6.29e-16	224	527	50	368	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA35171.3|GH5_24	5.45e-222	121	555	29	477
UQC80596.1|GH5_24	7.75e-221	125	555	83	512
QBZ62768.1|GH5_24	5.21e-220	157	555	13	410
APD14599.1|GH5_24	1.46e-218	148	555	3	412
AEO53175.1|GH5_24	7.90e-217	163	555	21	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	3.42e-44	206	540	8	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	6.56e-44	206	540	8	338	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
3VVG_A	6.38e-26	221	554	30	376	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	1.58e-25	221	554	30	376	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.68e-25	221	554	63	409	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	8.92e-49	206	540	41	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	7.42e-42	206	540	49	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|C0HLA0|GH5FP_CHAOB	1.83e-34	200	552	27	396	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P50400|GUND_CELFI	9.41e-23	204	540	46	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1
sp|P19487|GUNA_XANCP	1.21e-22	209	538	32	354	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
145	164