CAZyme Information: RL4_JR_05326-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_05326-RA-p1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
760		86617.37	8.9102

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000142:628701-631078(+)

Full Sequence      

MASTLRHRNVPSAKNSASDLVEAKPVQKAAAVREYYYLALVVITILAFVTRFWGINHPNE
VVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFVGWLVGYDGHFHFDNIGDSYIANKV
PYLAFRALPALLGALTVTVTYLIMWESGYSLPACILAAGLILFDNAHIGQTRLILLDATL
VFAMACSILCYIRFYKLRHEPFSRKWWKWLILTGFALSADISTKYVGLFAFVSIGSAVCI
DLWDLLNIRRIGGALTIPQFTNHFFARAFGLILMPFLFYLFWFQVHFAVLTRSGPGDDFM
SPEFQETLSDNAMLANAVTINYYDNLSIKHKETKAYLHSHPDQYPLRYDDGRVSSQGQQV
TGYPYNDTNNVWQILPSDGSEDAARPVRNHDLVRLRHLGTDTILLSHDVASPYYPTNQEF
TTTSHELALGERAADTLFEVRIENGKTGQEFKSVSSYFKFIHNPSKVAMWTHTTPLPDWG
HKQQEINGNKQIAASSNVWLVEDIVSLPEDSPRRAKPVRAVKSLPFLQKWFELQRSMFWH
NSQLTSSHPYASLPFQWPFLLRGVSFWTQNDTREQIYFLGNPLGWWLASSLLAVYAGIIA
ADQFSLRRGMDALDHRTRSRLYNSTGFFFLVWATHYFPFYVMGRQLFLHHYLPAHLASTL
VAGALVEFIFTNDAAEPEPPTYAQVKSGKKAAPGPKRHISARERLAGQSLMGAWIATGVI
LTVVAACWWFFLPLTYGYPGLSVEQIQRRKWLGYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	42	287	8.9e-71	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	36	760	23	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.46e-81	41	291	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	1.64e-76	528	752	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	7.38e-14	338	486	13	170	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	7.48e-07	319	377	3	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO65833.1|GT39	0.0	4	760	10	777
AEO54171.1|GT39	0.0	4	760	10	775
UQC80449.1|GT39	0.0	36	760	52	773
VBB72720.1|GT39	0.0	4	760	9	772
CDP23606.1|GT39	0.0	4	760	9	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	2.42e-97	38	755	51	728	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	4.33e-88	17	742	45	739	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42933|PMT4_SCHPO	2.74e-247	36	752	58	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q59X23|PMT4_CANAL	1.43e-246	34	760	44	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	7.44e-238	36	760	52	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|F1Q8R9|POMT2_DANRE	7.73e-114	36	672	69	694	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	9.20e-107	38	654	39	669	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999962	0.000051

TMHMM  Annotations     

Start	End
36	55
80	102
123	145
149	166
173	195
225	247
268	290
582	601
621	643
647	669
710	732