CAZyme Information: RL4_JR_04952-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_04952-RA-p1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
979	JACBXF010000067|CGC4	108505.98	7.3080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000067:2948595-2952738(+)

Full Sequence      

MRLRFVDQRVWEPCWTWSTLLALAACFSSAWAYDAVVCGKNGYAPSTNASLSYTANAWNP
VGSGFQCMSINNTPPSFAATWAWYEEPATVHSYPHVTFADQKIPVALNRIASLTLGAQWA
YGLGGAASVSASDRTVAHRLSAADAVANIAFDMFADADANKAQGATTASTEIMIWIGTVG
KPYPLGYSTKRTCFRQSVGGVYFTLYVGTNTRNATVFTWVTAANQTSFSQDVSPLLQYLW
RNKLVDGSVQLGVVELGTEAYHATTNVTFAASNFSMALEVGSAPQLKLQKMPRKCSGASP
RSVDGLVSRLCASITAICVFLALVPGLLISALKIPKESRILSPRTDMSSSRSSSTTSNPF
ADQPSQAPSLARTDSSSSDSSLPTVPPPAALPPHLGHRPAPPPPEDDLAITPAPQVAQGI
FNEKIDYDPEAAPAPSGVTDAEKREADGEVPGVKRSVFVRVHDWWRNTYCPKEEPALVLP
TCPTDEEKLSYLHTNRVPLYLFGLLSFFSLSAGMWLFALCSNVFLWYGAFVAFIDVYLGI
SYFVGIVGKDWDYADHQRMVEEHPITDETAPNVDVYLPVCMEPIEVLANTWAHVQKLDWP
AGKLTVYVLDDGDQAVVRALAEECGFQYIVRGDRPRLKKAGNLRWAFARTQGDFFTIFDA
DFCPRPDFLHEIVPEHLDDPKTAIVQSPQFFRIRDDQTWVEQGAGATQELFYRVVEVNRN
RWGASICVGSNAVYRREALVEVGGTADIGFSEDVHTGFGAVDRGWKVKYIPLCLATGVCP
PTPRAFFSQQMRWARGSTTLLTNSHFWVSKLSLIQKICYLCGFFYYSAVSVSIFISPIPG
ILLLWVRPEWFKFYNLAFAIPSLVYGLVVFRVWAKASYGLNVQHIMVIQSYAYLTAIKDR
LFNIELKWAPSGDAKAHKSHKYRNMRILCWVWTLAVLGGVISAVTYRIIHGLDWYQTLPL
LALNSYNNYVAHRFLFCNW

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	135	277	5.5e-26	0.9038461538461539
GT2	575	742	3.8e-24	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	3.22e-97	571	801	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	8.01e-43	514	894	2	382	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	7.07e-38	571	844	260	528	cellulose synthase catalytic subunit; Provisional
133059	CESA_CaSu_A2	2.72e-34	571	797	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
133045	CESA_like	4.48e-30	575	753	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY80099.1|GH12|GT2	0.0	33	979	1	882
AEO69079.1|GH12|GT2	0.0	83	975	48	885
VBB86309.1|GT2	2.22e-310	403	979	57	649
CAP68353.1|GT2	3.62e-309	420	979	85	649
CDP31824.1|GT2	3.62e-309	420	979	85	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	2.07e-33	564	838	121	419	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.83e-33	564	838	133	431	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.84e-33	564	838	134	432	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	3.32e-32	571	844	273	550	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5M2D_A	4.07e-14	20	275	5	231	CRYSTAL STRUCTURE 4Ac Endoglucanase-like protein from Acremonium chrysogenum [Acremonium chrysogenum ATCC 11550],5M2D_B CRYSTAL STRUCTURE 4Ac Endoglucanase-like protein from Acremonium chrysogenum [Acremonium chrysogenum ATCC 11550]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58932|BCSA_XANAC	3.90e-37	564	820	146	405	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	5.39e-35	564	838	142	421	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	6.23e-35	562	843	135	423	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	6.23e-35	562	843	135	423	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|P58931|BCSA_PSEFS	3.78e-34	522	825	115	419	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.239707	0.760264	CS pos: 32-33. Pr: 0.7212

TMHMM  Annotations     

Start	End
310	332
497	519
524	546
823	845
855	874
927	949