CAZyme Information: RL4_JR_04751-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_04751-RA-p1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766	JACBXF010000067|CGC8	85178.45	4.4894

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000067:2369618-2372055(-)

Full Sequence      

MRAVIFVLSWAAWAIGASAAAIPAATSSTAGVEALVQRRLPHHTNAFEFAIVNASQLSAA
EVDTYTVSSTDGGKILIEGNTLSALLTGLHRYLSDVVHIDIWWYIGSRLDAAPQALPTLA
TPLKGSSIVPYRYHFNTVTTSYTSAFWSWEDWELQLDWMALRGINLPLAWIGVEKIFIEV
FQEIGLTDDEIKTFLSGPAFLAWNHFGNIQGSWGGDLPFSWADSQFELQKKIVQRMVELG
MVPILPAFPGFVPYAITRVFPNANVSNGSSWQNFAPQYTRDTFLDPFDSLFQQLQVSFIA
KQKEAYGNISSYYALDQFNENNPASGDLGYLKNVTANTWQSLKAADADAKWVMQGWLFTS
NSDFWTNERIEAYLSGVTVDSDLLVLDLFSESQPQWQRTNSYYGKPWIWCQLHDYGHNMG
LYGQIENVTVNAIEAVSNSSSLVGFGLSMEGQEGNEIMYDLLLDQAWSQTPIDTAEYFHN
WVSARYEGTAGQLPDALYQAWEVVRPTVYNNTKLACNAVPKAIFELVPSTSGLVNRTGHH
PTTINYSPAVLVQGWQLLYSASQQDPSLLSNPAYAYDIVDWTRQVLSNAFIPAYQELVAT
YTNTTTRQSSQCQEAKLRAHGAKLTSLLTTLDAVLNTNDNFKLSTWITAARATAVGSLNS
SVADFLEYEARDQVTLWGPTGEISDYASKSWAGLVSEYYIPRWEMFVEYLVATPSSNYTQ
STFKAQLLEWEIKWASKTSSGGGDASQDLGTVLSSAVKQWGSVFNL

Enzyme Prediction     

No EC number prediction in RL4_JR_04751-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	72	748	1.7e-203	0.9803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	0.0	132	469	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	1.06e-79	477	739	1	243	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	3.86e-24	30	117	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX62920.1|GH89	0.0	11	766	4	755
QGA19502.1|GH89	0.0	14	764	12	766
UKZ88341.1|GH89	0.0	13	766	9	751
UKZ51971.1|GH89	0.0	13	766	9	748
UKZ63441.1|GH89	0.0	13	766	9	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	4.34e-142	30	731	7	682	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.74e-92	63	739	202	851	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.01e-92	63	739	210	859	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.88e-91	63	739	225	874	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	4.31e-141	30	731	30	705	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	1.18e-128	22	734	39	770	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999707	CS pos: 19-20. Pr: 0.9728

TMHMM  Annotations     

Start	End
5	27