CAZyme Information: RL4_JR_04284-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_04284-RA-p1
• CAZy Family: GH162
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	JACBXF010000067|CGC5	54604.64	6.5037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000067:847618-849143(-)

Full Sequence      

MALPFQRPHAHCRTFSSDAIEEVIKDVTSRMKNPDLARVFENAFPSTTDTTVKFHTNGTT
KPAKSKTGSQGTQDEGKWEGAQSFVITGDIIAEWLRDSTNQLAPYQPLAKKDRAIFDLIL
GAINTQAEFVIQSPYCNAFQPPPISGLHHSHNGQNDNVHPAYEPSFVFECKYELDSLAHF
LALSNEFYKHTESVDYLTPRWFLALETLLRVLNEQAMSTFDPTTHRYRRNQYTFQRVTNA
GTETLNLGGIGNPLNNGTGLVRSAFRPSDDATILGFFIPANAMMAVELKRTAGVLKAAGK
TALAESVSRWSKQITDGIWEHGVVKHREFGDVFAYEVDGYGSHILMDDANYPSLLALPLM
GFVPATDPTYRNTRRMLLSEKSNPYYLKGQQFQGIGGPHIGVQNAWPMSLLIQAQTSEDD
EEIKQCLDFVLNSARLGLVHESVDVNYIATYTRSWFAWANGVFAATILDLAKRKPHLIFK
EPATPYEI

Enzyme Prediction     

No EC number prediction in RL4_JR_04284-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	33	468	1.9e-160	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	33	468	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	4.06e-163	12	477	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
395586	Glyco_hydro_15	0.005	282	387	183	281	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI20401.1|GH125	2.85e-277	1	488	58	545
UQC89947.1|GH125	1.07e-270	1	488	585	1070
CEI62897.1|GH125	2.16e-269	2	488	56	543
QPC60340.1|GH125	4.13e-267	2	488	56	543
QPC71621.1|GH125	4.13e-267	2	488	56	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	2.97e-91	7	470	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	7.47e-91	7	470	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	2.21e-90	7	470	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	2.05e-72	14	469	2	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	2.54e-72	14	469	2	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.23e-178	1	480	45	506	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_04284-RA-p1.