CAZyme Information: RL4_JR_04057-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_04057-RA-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
734		79308.46	5.4369

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000067:161925-164557(-)

Full Sequence      

MDKIEQLLEQLTLEEKCRLVAGKNMWETVDVPRLGIGSLKTTDGPAGVRGATWIDGTHTT
FIPCGIALAATFDRDLVETIGGVLGAEARSKNSHVLLAPTINISRSPLGGRNFENFGEDP
FLTGTMAGRYIRGVQSADGVGACMKHYVANDMETRRFNMDEQIDERTLREIYLRPFEMVA
ADSDSEDEADAADKNAKPKKRGSKRPWTGMAAYPKINGHHADCNTFLLQEILRKEWGYDE
LVMSDWGGLNDTVESIVAGTDLEMPGPPIRYGAALEKAVRDGKVLEREHLDASISRLLKL
LDKAGLLRSPANATEATSAPASTAPSGSERNSDLPEFRQAARDAATGGIVLLKNEGNVLP
LKPKGIKTLAIIGPNAKKPTTGGTGSAAVNPYYITNPYDSLCAAVRAENPDIEILYAQGC
VTNIQPPLLGDLLNTPDSDRKAGMRVEFFAGHDFSGPAIGGARHWQNSLAFMMSDGDTPD
SLKGRPHCYRASGILTPGEAGVYNLSLSSTGKAKLYLDGKLIIDNSDWSQPGGTFMNCGS
VNLMADPPVVLEKGREYHLRLDNIVVPPPLRPHDNTLFHTLSGVRIGMERLVEGLEAALF
SEALAAARKADVVVAVFGHNNDTEKEGVDRTSLHLPRRSDELISALCETNTNTVVVTQSA
SAISMEGWSERAAAVVHAWFQGQENGNALADVLLARNDSSPSGKLPITFPRRLEDHGSHP
WFPGDAVNDHATYV

Enzyme Prediction     

No EC number prediction in RL4_JR_04057-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	30	265	4.7e-59	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	9.37e-66	23	384	47	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	8.16e-52	54	711	113	601	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	8.92e-47	349	715	1	195	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	4.88e-34	33	300	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.74e-30	7	421	56	468	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28473.1|GH3	8.75e-294	4	733	11	704
QMW31943.1|GH3	5.33e-264	4	733	9	700
BAE61700.1|GH3	2.15e-263	4	733	9	700
UDD60911.1|GH3	2.15e-263	4	733	9	700
QMW43976.1|GH3	6.10e-263	4	733	9	700

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.05e-110	4	716	6	677	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.75e-106	4	716	6	677	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.66e-84	4	733	5	522	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	2.95e-70	6	733	56	684	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
2X40_A	6.59e-69	1	393	1	377	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.12e-139	3	728	10	680	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|B8NDE2|BGLI_ASPFN	7.55e-134	4	719	6	667	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q4WLY1|BGLJ_ASPFU	1.05e-133	4	719	14	691	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|A1DNN8|BGLJ_NEOFI	2.01e-133	4	719	14	690	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	2.90e-133	4	719	14	691	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_04057-RA-p1.