CAZyme Information: RL4_JR_03713-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_03713-RA-p1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		32903.52	4.2335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000149:2668592-2669515(+)

Full Sequence      

MKSIFVLQAFAAAASALGGLLVPFYEYPYGDDALADWNALVTAIDAHPEIPFYVIINIDN
GGPYSPNPPSGIKDFAFWIDALNSRNNAKAIGYVHTSYGSRNASLMLDAVDNYANWTTNA
GRSSNSSAYNIQIDGIFFDEIDTAPAKLDYNTEITSYAKSVFASRGGPIVLNPGVLVQAG
SESLFNIADSIVQIETCYTNSSGATDSDYTQRCAPGTYTPFTESLLDTLGNETITAKSSV
IVHDFYDNFSPYGAAALSTLESSIVAASNKGLHSFYMSLFGYTGNFTVSPASIINVATYA
AQSQIKR

Enzyme Prediction     

No EC number prediction in RL4_JR_03713-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	20	246	7.6e-38	0.810126582278481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	1.27e-37	25	245	1	190	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY60853.1|GH135	8.43e-82	1	304	1	303
UQC82105.1|GH135	8.73e-72	1	304	1	303
QQK42578.1|GH135	1.53e-23	12	200	15	188
EED17159.1|GH135	1.14e-22	1	276	1	230
GAA95568.1|GH135	1.38e-22	12	278	10	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C5G_A	3.50e-15	20	198	10	175	Crystal Structure of Aspergillus clavatus Sph3 [Aspergillus clavatus NRRL 1]
5D6T_A	4.44e-15	20	198	28	193	Crystal Structure of Aspergillus clavatus Sph3 in complex with GalNAc [Aspergillus clavatus NRRL 1]

Swiss-Prot Hits     

RL4_JR_03713-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000877	0.999097	CS pos: 18-19. Pr: 0.7003

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_03713-RA-p1.