CAZyme Information: RL4_JR_03530-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_03530-RA-p1
• CAZy Family: GH12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		67760.47	6.8469

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000149:2157672-2159796(+)

Full Sequence      

MWPFSSTYPERDLADVAGQTFDYIIVGGGTAGCVLARRLSEDAGVSVLLVERGPVCDSWL
SRIPLLSQNHAMPFVPGIAGRYSGPIPDCLGRRFALAGAEGLGGTTLINGMLHTRGPPGG
YAAWAQQRGLRGWDWDDVEPYFRKMENALHRPGDASRGHDGPLLNRQPGHLYSFSSYMPK
ACAALGLPVEEDCNVPSASAQGYFRLDSTIAPDGTRWSANRAYLPRDLVAARQAHLAVCT
GVIATRLAIDDRQAATGVYMATAAVPGSPEVLVSARREVILCGGALRTPQLLLLSGIGPA
ADLAALDIPSVHDLPAVGAHLADHLAVPVMIEMPVRDTTHRLLTVLGFVWNLLLYLLLGR
GVLGASTTPATVFVRSNSLDDEMLVTKTPAGREDAGREDAGREDAGRPENVPDVEIMLIP
VNTVSRDLAGRSFLSLYTALLQACTQGGRVALASRDPRAHPAIAYPFLSTAADWQVLRKA
VRFTMRLADAFIGGSGYPGPAALTVAPGIDAEVLQQLTPDVEWSASGTKEKPPAPANTRT
VDLPPLAPAAWRSVTDAQIDAYARRTAQSSLHYACSCRMATSARDGVVDARLRVHGLAGL
RIADASVLPVMPSAHTMAAVLMVAERCANFIKEERS

Enzyme Prediction     

No EC number prediction in RL4_JR_03530-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	19	633	4.7e-140	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.96e-103	19	632	4	532	choline dehydrogenase; Validated
225186	BetA	8.06e-85	14	635	1	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	8.03e-54	22	631	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.45e-35	91	326	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.75e-32	448	627	5	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS92880.1|AA3_2	2.08e-186	1	633	1	613
QBZ58631.1|AA3_2	1.88e-165	2	633	3	654
UKZ47954.1|AA3	1.05e-147	28	633	1345	1912
VBB80495.1|AA3_2	5.94e-120	3	634	49	671
CDP28838.1|AA3_2	6.51e-119	3	634	49	671

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	3.93e-48	16	631	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	3.93e-48	16	631	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	3.93e-48	16	631	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	4.99e-48	16	631	19	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
7AV4_AAA	5.98e-48	16	631	79	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3K5H3|BETA_PSEPF	2.25e-69	19	632	3	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1
sp|A6VEI3|BETA_PSEA7	1.03e-68	19	632	3	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=betA PE=3 SV=1
sp|Q9HTJ2|BETA_PSEAE	2.78e-68	19	632	3	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=betA PE=3 SV=1
sp|B7V5R3|BETA_PSEA8	2.78e-68	19	632	3	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=betA PE=3 SV=1
sp|Q02DZ0|BETA_PSEAB	3.87e-68	19	632	3	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999373	0.000666

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_03530-RA-p1.