CAZyme Information: RL4_JR_03516-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_03516-RA-p1
• CAZy Family: GH12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	JACBXF010000149|CGC13	36587.73	4.3798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000149:2096146-2097236(-)

Full Sequence      

MKFLATQVAAVALLAASTAFSSPILGRTGTSCQATAQWPGWAGIKYAFIFGDSYTQTGFN
YTLTPAPSRDNPLGNPPYPGYTSSNGPNWVGFLTTKYNASRLQTYDLAYGGATVNATLVA
PYQPSVLSLIDQVRAEFLPGYAGANPTAADPPAWQGGDSLFAVWIGINDVGSTYYLGDSE
TAALQDQIVAQYASLVDDLHAVGARSFAFLTVPPVDRSPLARNNSAEAQAREKTAIEAFN
VRVATMASSFAARNDTNVWVLDTQPLFTAVLDNPAAFPQTAHLQNTTDYCEAYASGTPGP
DTFVASCGVPASAYFWINNLHPTSAIHDVVAEQLALALANGPNTCS

Enzyme Prediction     

No EC number prediction in RL4_JR_03516-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	49	334	7.3e-76	0.9850187265917603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	3.12e-64	48	335	3	268	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.53e-16	48	334	4	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	2.23e-15	18	339	3	334	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	1.61e-11	48	332	5	275	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	1.38e-05	48	334	2	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA06788.1|CE16	3.44e-120	22	345	22	341
ATZ46260.1|CE16	2.27e-118	6	345	7	341
UJO22905.1|CE16	3.97e-100	21	340	17	330
CAE7178865.1|CE16	7.04e-98	11	338	7	322
UQC91385.1|CE16	8.86e-94	59	345	24	304

PDB Hits     

RL4_JR_03516-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	7.33e-61	45	335	32	294	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	2.28e-59	45	335	32	294	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|A7J2C6|AES1_HYPJE	2.37e-07	45	333	28	330	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999759	CS pos: 26-27. Pr: 0.9247

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_03516-RA-p1.