CAZyme Information: RL4_JR_03427-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_03427-RA-p1
• CAZy Family: GH11
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228	JACBXF010000149|CGC11	23933.85	5.2294

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000149:1855135-1855869(+)

Full Sequence      

MLLIPTLVPSALLLLLSGASAQSTGSTTRYWDCCKPSCGWPGKATLAQGPVLSCDKNNTP
LSDNGDTKSGCDGGGAFMCSSQTPWALNDTVSYGFAAVRIAGGDESTWCCACYELTFTSG
DVKGKKLIVQATNTGGDLGSNHFDLAMPGGGVGIYNACTSQYGAPSNGWGERYGGVKTRA
DCDAFPEALKAGCQWRFDWFLGADNPTVTFREVTCPSELTAKTGCRRN

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	25	225	1.2e-91	0.98989898989899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	2.64e-78	24	226	1	214	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56098.1|GH45	4.02e-126	19	227	18	227
UQC88154.1|GH45	7.83e-123	19	227	21	233
AGY80100.1|GH45	2.55e-120	21	227	3	209
VBB72572.1|GH45	6.34e-120	15	227	13	225
AEO65930.1|GH45	7.04e-120	21	227	21	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	2.44e-103	20	228	21	224	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	3.09e-102	21	228	1	203	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	3.55e-102	21	228	4	206	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1HD5_A	2.79e-98	25	228	3	202	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]
2ENG_A	2.92e-97	25	228	3	202	Endoglucanase V [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43316|GUN5_HUMIN	1.66e-96	25	228	3	202	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|P45699|GUNK_FUSOX	2.41e-94	16	228	13	222	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|D3GDK4|GUN_CRYAT	2.68e-86	11	227	8	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	3.57e-55	25	225	40	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	5.16e-50	25	228	269	501	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999773	CS pos: 21-22. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_03427-RA-p1.