CAZyme Information: RL4_JR_03115-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_03115-RA-p1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		85930.72	5.7189

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000149:864994-867577(+)

Full Sequence      

MKTMPTKPEATAAVGPRTPSLAPAPLGEWWNETQWAVLLSLLDAIVTPIVASDDPRRQGS
AVEPEDGFDFDRTSVQRLPRRAYDEAVDRARASMVDPPSASAIADYLADRPSDSVAFQHG
LRRAVSGLTTDLRNQLGGILSILSWSSGAFLLTGYYTPVQQQPVDVREAILRGWSASWLP
DLRKLARSVYALAQTSYLLTAPRFRQVSGYADVPAGWTASTSVPAYDFVQFGGDTDTASL
ETDVVIVGSGCGGAVCAQVLAAAGHRVVVVDKAYHYPPEQLPLPQETGTRLLYENGGILA
STDPCINVLAGACWGGGGTINWSVCLRPPAYVRREWAGDDQQSGMAFVTSSAFDACLDRV
CDFMGVHEPDVRPADAEDQSHRGRVLLDGAAKLGWAAAPLLQNTRGGRPHDCGHCHLGCA
SAQKRGTAVRWLPAAAADGAQFVEGFHVDRVLFDGDDGSSEQTPITIPLQEAEEAPRATG
IVGTWLSRDADGSTTGPEDQRTKRRVVIKAKRVIVSGGSLCSPLVLLRSGLTNPQIGKNL
HLHPCNFVGAYFDEETKPMDKGIITSICTSFEDLDGRGHGPRLESTCMVPYAILANLPWR
SGLDFKLAALRYRHYDGFIALTRDRGSGRVLPDRHTGQPVVDYHPDPVDREHAVEGVIGL
ARLCHAAGAREIRAYLPGVPPFLRPDAITEPADTADTADTAFENWITSVRAAGNALSALW
NAGKAWATTTPFASAHQMGTCRMGDDAGAASVVDPRGRVWGTRGLYVADASVFPSASGVN
PMVTTMAFADWIAQSVAASLADA

Enzyme Prediction     

No EC number prediction in RL4_JR_03115-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	235	798	1.2e-64	0.9781021897810219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	3.23e-49	292	545	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	3.50e-41	235	801	1	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.35e-29	623	789	2	140	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	2.94e-10	736	793	473	528	choline dehydrogenase; Validated
274888	Rv0697	1.11e-08	665	797	353	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	3.85e-180	1	801	1	735
BCS21375.1|AA3_2	6.19e-09	441	797	181	530
ADT70776.1|AA3_1|AA8|1.1.99.18	8.07e-09	146	798	157	782
BCS07163.1|AA3_2	3.44e-08	243	778	6	547
QQK45533.1|AA3_2	4.29e-08	441	797	181	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI6_A	7.79e-07	137	781	148	749	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4UDP_A	1.10e-06	495	796	244	527	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
6F97_A	1.10e-06	495	796	244	527	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4QI4_A	1.54e-06	243	781	9	527	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4UDR_A	1.92e-06	495	796	244	527	Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688],4UDR_B Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	1.25e-85	139	800	99	746	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	9.05e-73	240	796	235	740	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	2.56e-68	139	800	90	742	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|Q9LW56|FAO3_ARATH	1.22e-67	236	800	227	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|Q9ZWB9|FAO1_ARATH	1.82e-62	234	797	238	749	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.979538	0.020454

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_03115-RA-p1.