CAZyme Information: RL4_JR_02896-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_02896-RA-p1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546		59743.40	5.2257

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000149:252267-253960(-)

Full Sequence      

MHTSSFVAVVSALATFALSSPIPARDSGSSWTNKTWADLVITAPVQGRYLHRNLSGDPFM
WVADTNWELFHRMNRTDIDLYLADRAAKGFNAIMGVAASKLNATTIPNFSGELVFENDDP
ATPNDKYFDFVDFVVERAAEYGILVCILPTWGRYVNNGWYGKIGPILFNDSNAEAYGYYL
GKRYPGIPKILGGDSNTWWADNVPEARAAWQANKSVDPFSVLDPVTDTRHVWAAMLRGLQ
RGEAEHSYDTFAVYHPTGAWITGTPKAYGHNMLNGSYGRVSVDAIQSGHQTPSDDLYTNL
TLLTIFDATKNYEYITEMRSQFSGPVVDIENHYEGAHHDFVLSTPVWNASHVRHGFYSAV
FSGACGYTYGALSTEQSYENASNVASPSQYTTPQLNLDANASWHEDLHLPGAAQAGYVAR
LFASLPRAQFDALEPARDLLSSPSDASADVLAFDGDRYVSGIATTGHFWAYAGHGDTFQL
DLTAVAQRWGLPVGTTVHAQWFNPRTAKLADVDGVLAASGSKVFVPPTSGGVDHDWVLVV
KATSVC

Enzyme Prediction     

No EC number prediction in RL4_JR_02896-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	46	538	1.2e-73	0.9805825242718447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	2.00e-98	47	425	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	4.87e-14	455	540	12	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	7.44e-190	3	541	4	534
KAF3763706.1|GH140	4.29e-176	29	540	20	535
KNX49908.1|GH140	4.55e-83	39	541	14	518
KAE8135280.1|GH140	2.87e-71	22	540	12	507
KAE8156220.1|GH140	5.63e-71	22	540	12	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	2.62e-22	32	544	6	448	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	4.86e-21	32	544	6	448	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	1.00e-19	36	509	26	431	Chain A, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

RL4_JR_02896-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000298	0.999694	CS pos: 25-26. Pr: 0.8641

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_02896-RA-p1.