CAZyme Information: RL4_JR_02733-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_02733-RA-p1
• CAZy Family: CE3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	JACBXF010000032|CGC11	53203.52	5.0074

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000032:3412571-3414064(+)

Full Sequence      

MALQRLSYVAALLSLASVSLSAPTKRDTVTTCLQNAQVPVSLQNTADWTQDGTAYNLRVP
IQPAAIVVPTSIAHIAAAVSCGVQNSVPVSAKGGGHSYTSLGFGGEDGHLVIEMNRMFNV
VLDNTTNVATVQPGARLGHLANELYNQGQRAFSHGTCPGVGVFGHSLHGGYGLFSHKHGL
AVDWIVGATVVLANATVVHCSETENTDLFWAIRGAGDSFGIVAELEFNTFAAPEQVTYFE
IQLNFTAANAAQSLLNVQTFIKTSPAELTFQIAMTKAKGYVIVGAYLGDEASFRAVFDPL
LAQIGGTFTTLQTSGWLEQLAHFAGTTETDVTTTSYSAHDNFYASSMLVPELTLAHFESF
VSYLTSTAFVSDDSHSWFVQMDSYGGETSAVSAHSNAASAFAHRDKLLLFQLYDYVATDQ
TYPASGVSFVNGFRDSVTSLLADGTWGVYANYPDQQLTSAVAQSLYWGVNLPRLQQIKAV
LDPTNLFRNPQSIEPAS

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	54	493	7e-92	0.9868995633187773

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	2.09e-32	58	496	27	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.41e-28	63	201	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	1.87e-14	448	494	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
273751	FAD_lactone_ox	3.54e-07	69	222	21	171	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
215242	PLN02441	3.22e-05	63	222	65	231	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL01114.1|AA7	5.24e-193	12	495	12	490
QGI84728.1|AA7	5.11e-189	9	495	10	493
CCT71747.1|AA7	5.11e-189	9	495	10	493
QGI98385.1|AA7	5.11e-189	9	495	10	493
QGI67502.1|AA7	5.11e-189	9	495	10	493

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Y0R_AAA	7.40e-189	12	495	10	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
5K8E_A	8.22e-138	17	496	15	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6YJO_A	2.42e-135	32	497	38	505	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
1ZR6_A	8.47e-131	27	495	7	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	1.92e-129	27	495	7	478	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2K2|CHITO_GIBZE	3.81e-188	12	495	10	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|E9F5F1|SUBF_METRA	7.41e-157	27	497	27	493	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|P9WEY2|DPMAF_METAN	1.05e-156	32	497	32	493	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|G2QG48|XYLO_MYCTT	4.23e-137	17	496	15	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	1.06e-132	5	495	3	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000196	0.999766	CS pos: 26-27. Pr: 0.9680

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_02733-RA-p1.