CAZyme Information: RL4_JR_02594-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_02594-RA-p1
• CAZy Family: CE16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	JACBXF010000032|CGC11	57505.25	4.8382

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000032:3054112-3055821(+)

Full Sequence      

MHWIAKTVGLVGLSVVVGPVGASPVQSRSKPSYVSHPDRAAAVKAAFQLSWDGYYKYAFP
HDSLLPANNSYDDDRNGWGASAIDGFSTALIMGADKAVEQILAHVQTVDFDTSVGSISLF
ETTIRYLGGLLSAYDLLNGPLKQYATNKTAVDNVLVQAKKLADNLKVGFNTASGVPDNTL
LFSPPRINGSTTNGVATIGTLILEWQRLSDLTGDPQYGLLAAKGESYLLNPQPLPLAEPF
PGLIGTNVNITNGQFIDGYGGWVGGDDSFYEYLIKMFIYNPQKFSSYKDRWVSAADSTIK
YLASHPASRPDLTFLAYYRGTKPIFYSQHLACFDGGNFILGGLTLNESRYIDFGLELTAA
CHETYTATATQIGPETFRWQDNGEKAALNATNNPAPPSNQTAFFKKNGFWIGSADYVLRP
EVIESYYYAYRATGDTKYQEWAWDAFLAINKTCAVGSGYSAINDVNVAGGGGNSNFQESF
WFAEVLKYSYLIQAEDSVYQVQPDHSNQFVYNTECHPVLIPGGEQT

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	46	518	4.6e-122	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.56e-176	46	520	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	5.15e-111	39	521	72	519	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ERS98086.1|GH47|3.2.1.113	2.79e-274	1	520	1	525
AEO64117.1|GH47	1.29e-257	22	525	23	524
AEO58874.1|GH47	5.32e-239	16	524	17	521
CAP66683.1|GH47	7.67e-228	22	525	40	548
CDP28418.1|GH47	7.67e-228	22	525	40	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	1.78e-194	14	520	17	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	9.50e-193	35	520	1	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1HCU_A	4.13e-191	36	520	12	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	5.90e-58	19	520	6	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	7.22e-58	19	520	4	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12563|MNS1B_ASPPH	1.49e-195	1	520	1	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|A2QAS2|MNS1B_ASPNC	1.49e-195	1	520	1	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|P31723|MAN12_PENCI	9.15e-194	14	520	17	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|A1CP08|MNS1B_ASPCL	2.12e-192	39	520	35	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q0D076|MNS1B_ASPTN	1.45e-189	39	520	39	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000330	0.999643	CS pos: 22-23. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_02594-RA-p1.