CAZyme Information: RL4_JR_02588-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_02588-RA-p1
• CAZy Family: CE16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
734	JACBXF010000032|CGC18	78855.09	6.6049

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000032:3039502-3041790(-)

Full Sequence      

MDIFSVPVATTPPPAQIPCRDDHPLPRLGVDEGTRQACEPVQTNKFYANLLLGEQDCPAY
VTPYAVSWTKGRSPSCGWGLTVSHATADQRVFGPPACRHGAASAGYYFSPPIVQNVVLDA
AELGAGTALTLEKPTDLSVTVALRAGAGRAPAVRFPLVQGQGFVTAVYDGATPVVRSAMA
IVDLACTGEPKPGVRRFVLRMNDGAAWLLYARHRPGTRPLALRRTHASTVVGSTSVFWGS
VQVARLVDDGSSQAVFDRASGVFAAGVRLSGDASGRYTLSFQKTDAAGGGGGSGDGGFLA
RSPLVMFALPHHCASFDERTRGGLTAVAMQTTVKGVAHAVLGDAWTLVEPALPQNMGFLP
WDPKTRQPAPPLAPAVQQLAREVARQELSQDVDAQTNLDSMYFSGKGLAKFATIVLCVHD
MLDDRALAAKGLGQLQAAFGRFAENRQQHPLVYDRAWGGVVSSAAYTTGDLLVDFGNAGY
NDHHFHYGYFVYAAAVIDHLDPGWLAAHAAYVDLLVRDYANPSRRDPFFPVFRSFDWYHG
HSWAHGLFASMDGKDQESSSEDIMAAYALKMWGAVRGDAALEARGNLMLAVLARALPLYY
YYGDDNTTQPPAFRANRVAGILFENKIDHTTYFGASPEYIHGIHMIPLLPCSPYCRPLPF
VAAEWADVFSGGRVDDVPGGWRGILYGNLATLDPAAAYAFFSSPGFDPGTLDGGASRTWY
LCYSGALLGCHEHE

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	34	723	6.8e-204	0.9790996784565916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	3	727	54	755	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	372	721	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.50e-122	23	363	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO64126.1|GH81	2.83e-277	2	729	168	874
AEO58881.1|GH81	5.20e-256	2	727	103	837
CAP66697.1|GH81	1.50e-253	2	729	252	959
CDP28432.1|GH81	1.50e-253	2	729	252	959
VBB80051.1|GH81	6.67e-246	2	714	252	944

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.27e-86	41	721	41	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	3.71e-86	41	721	66	737	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.17e-84	41	721	41	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.21e-29	387	697	326	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.16e-21	393	647	353	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.51e-218	2	724	192	899	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	5.68e-149	1	729	1	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.30e-145	23	727	66	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	2.57e-136	2	727	74	778	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.45e-135	2	728	427	1142	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999362	0.000663

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_02588-RA-p1.